Agalsidase alfa
Explore a selection of our essential drug information below, or:
Identification
- Summary
Agalsidase alfa is a recombinant human alpha-galactosidase indicated to treat Fabry disease, a genetic deficiency in the enzyme leading to buildup of globotriaosylceramide.
- Brand Names
- Replagal
- Generic Name
- Agalsidase alfa
- DrugBank Accession Number
- DB15874
- Background
Agalsidase alfa is a recombinant human α-galactosidase A similar to agalsidase beta. While patients generally do not experience a clinically significant difference in outcomes between the two drugs, some patients may experience greater benefit with agalsidase beta.1,2 Use of agalsidase beta has decreased in Europe, in favor of agalsidase alfa, after a contamination event in 2009.6
Agalsidase alfa was granted EMA approval on 3 August 2001.8
- Type
- Biotech
- Groups
- Approved
- Biologic Classification
- Protein Based Therapies
Recombinant Enzymes - Protein Structure
- Protein Chemical Formula
- C2029H3080N544O587S27
- Protein Average Weight
- 45351.6 Da
- Sequences
>Agalsidase alfa sequence LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCI DDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGY YDIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPF QKPNYTEIRQYCNHWRNFADIDDSWKSIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIG NFGLSWNQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQL RQGDNFEVWERPLSGLAWAVAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVK RKLGFYEWTSRLRSHINPTGTVLLQLENTMQMSLKDLL
Download FASTA FormatReferences:
- NCBI: Galactosidase Alpha Gene [Link]
- Synonyms
- Agalsidase alfa
- Agalsidase alfa (genetical recombination)
- Agalsidase alpha
- alpha-D-galactopyranosidase
- alpha-D-galactosidase
- alpha-D-galactosidase enzyme
- alpha-D-galactoside galactohydrolase
- alpha-galactisidase
- alpha-galactosidase A
- Recombinant alpha-galactosidase A
- External IDs
- DRX-005B
- DRX005B
- EC 3.2.1.22
Pharmacology
- Indication
Agalsidase alfa is indicated in the treatment of Fabry disease.7
Reduce drug development failure ratesBuild, train, & validate machine-learning modelswith evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets.- Associated Conditions
Indication Type Indication Combined Product Details Approval Level Age Group Patient Characteristics Dose Form Treatment of Fabry's disease •••••••••••• •••••••• Treatment of Fabry's disease •••••••••••• ••••••••• - Associated Therapies
- Contraindications & Blackbox Warnings
- Prevent Adverse Drug Events TodayTap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events with our Clinical API
- Pharmacodynamics
Agalsidase alfa is a recombinant human α-galactosidase A used as enzyme replacement therapy in the treatment of Fabry disease.7 It has a long duration of action and a wide therapeutic index.7 Patients should be counselled regarding the risk of infusion related reactions and hypersensitivity.7
- Mechanism of action
α-galactosidase A is uptaken by cells via the mannose 6 phosphate receptor.3 Agalsidase alfa hydrolyzes globotriaosylceramide and other glycosphingolipids that would normally be hydrolyzed by endogenous α-galactosidase A.7 Preventing the accumulation of glycosphingolipids prevents or reduces the severity of manifestations of Fabry disease such as renal failure, cardiomyopathy, or cerebrovascular events.7
Target Actions Organism UGlobotriaosylceramide metabolizerligandHumans - Absorption
A dose of agalsidase alfa in non end stage renal disease patients reaches a Cmax of 3710 ± 855 U/mL with an AUC of 256,958 ± 63,499 min*U/mL.5
- Volume of distribution
The volume of distribution at steady state in non end stage renal disease patients was approximately 17% of body weight regardless of sex.5,7
- Protein binding
Agalsidase alfa is not expected to be protein bound in circulation.7
- Metabolism
Data regarding the metabolism of agalsidase alfa is not readily available.7 However, protein drugs are expected to be degraded by proteases and other catalytic enzymes to smaller peptides and amino acids.4
- Route of elimination
After nonspecific proteolysis, the amino acids from protein drugs are reused for protein synthesis or further broken down and eliminated by the kidneys.4
- Half-life
The elimination half life was 108 ± 17 minutes for males and 89 ± 28 minutes for females.7
- Clearance
The clearance for doses of 0.007-0.2 mg/kg were 2.66 mL/min/kg for males and 2.10 mL/min/kg for females.7
- Adverse Effects
- Improve decision support & research outcomesWith structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!Improve decision support & research outcomes with our structured adverse effects data.
- Toxicity
Data regarding overdoses of agalsidase alfa are not readily available.7 Patients experiencing an overdose of agalsidase alfa may experience an increased incidence and severity of adverse effects. Overdose can be managed through the use of symptomatic and supportive measures.
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Drug Interaction Integrate drug-drug
interactions in your softwareAgalsidase beta The therapeutic efficacy of Agalsidase beta can be decreased when used in combination with Agalsidase alfa. Amiodarone The therapeutic efficacy of Agalsidase alfa can be decreased when used in combination with Amiodarone. Chloroquine The therapeutic efficacy of Agalsidase alfa can be decreased when used in combination with Chloroquine. Gentamicin The therapeutic efficacy of Agalsidase alfa can be decreased when used in combination with Gentamicin. Migalastat The serum concentration of Agalsidase alfa can be increased when it is combined with Migalastat. - Food Interactions
- No interactions found.
Products
- Drug product information from 10+ global regionsOur datasets provide approved product information including:dosage, form, labeller, route of administration, and marketing period.Access drug product information from over 10 global regions.
- Brand Name Prescription Products
Name Dosage Strength Route Labeller Marketing Start Marketing End Region Image Replagal Injection, solution, concentrate 1 mg/ml Intravenous Takeda Pharmaceuticals International Ag Ireland Branch 2016-09-08 Not applicable EU Replagal Solution 1 mg / mL Intravenous Takeda 2004-03-18 Not applicable Canada Replagal Injection, solution, concentrate 1 mg/ml Intravenous Takeda Pharmaceuticals International Ag Ireland Branch 2016-09-08 Not applicable EU Replagal Injection, solution, concentrate 1 mg/ml Intravenous Takeda Pharmaceuticals International Ag Ireland Branch 2016-09-08 Not applicable EU
Categories
- ATC Codes
- A16AB03 — Agalsidase alfa
- Drug Categories
- Alimentary Tract and Metabolism
- alpha-Galactosidase, antagonists & inhibitors
- Amino Acids, Peptides, and Proteins
- Enzyme Replacement Therapy
- Enzymes
- Enzymes and Coenzymes
- Galactosidases
- Glycoside Hydrolases
- Hydrolases
- Hydrolytic Lysosomal Neutral Glycosphingolipid-specific Enzyme
- Protein Isoforms
- Proteins
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
- Not Available
Chemical Identifiers
- UNII
- 2HLC17MX9G
- CAS number
- Not Available
References
- General References
- Germain DP, Elliott PM, Falissard B, Fomin VV, Hilz MJ, Jovanovic A, Kantola I, Linhart A, Mignani R, Namdar M, Nowak A, Oliveira JP, Pieroni M, Viana-Baptista M, Wanner C, Spada M: The effect of enzyme replacement therapy on clinical outcomes in male patients with Fabry disease: A systematic literature review by a European panel of experts. Mol Genet Metab Rep. 2019 Feb 6;19:100454. doi: 10.1016/j.ymgmr.2019.100454. eCollection 2019 Jun. [Article]
- Wilcox WR, Feldt-Rasmussen U, Martins AM, Ortiz A, Lemay RM, Jovanovic A, Germain DP, Varas C, Nicholls K, Weidemann F, Hopkin RJ: Improvement of Fabry Disease-Related Gastrointestinal Symptoms in a Significant Proportion of Female Patients Treated with Agalsidase Beta: Data from the Fabry Registry. JIMD Rep. 2018;38:45-51. doi: 10.1007/8904_2017_28. Epub 2017 May 17. [Article]
- Prabakaran T, Nielsen R, Satchell SC, Mathieson PW, Feldt-Rasmussen U, Sorensen SS, Christensen EI: Mannose 6-phosphate receptor and sortilin mediated endocytosis of alpha-galactosidase A in kidney endothelial cells. PLoS One. 2012;7(6):e39975. doi: 10.1371/journal.pone.0039975. Epub 2012 Jun 29. [Article]
- Katsila T, Siskos AP, Tamvakopoulos C: Peptide and protein drugs: the study of their metabolism and catabolism by mass spectrometry. Mass Spectrom Rev. 2012 Jan-Feb;31(1):110-33. doi: 10.1002/mas.20340. Epub 2011 Jun 22. [Article]
- Pastores GM, Boyd E, Crandall K, Whelan A, Piersall L, Barnett N: Safety and pharmacokinetics of agalsidase alfa in patients with Fabry disease and end-stage renal disease. Nephrol Dial Transplant. 2007 Jul;22(7):1920-5. doi: 10.1093/ndt/gfm096. Epub 2007 Mar 29. [Article]
- Pisani A, Riccio E, Sabbatini M: Agalsidase alfa and agalsidase beta in the treatment of Fabry disease: does the dose really matter? Genet Med. 2015 Jan;17(1):21-3. doi: 10.1038/gim.2014.79. Epub 2014 Jul 10. [Article]
- EMA Summary of Product Characteristics: Replagal Agalsidase Alfa Intravenous Injection [Link]
- EMA: Replagal Authorization Details [Link]
- External Links
- 259351
- Wikipedia
- Alpha-galactosidase
Clinical Trials
- Clinical Trials
Phase Status Purpose Conditions Count 4 Active Not Recruiting Treatment Fabry's Disease 1 4 Completed Treatment Fabry's Disease 2 4 Unknown Status Treatment Fabry's Disease 1 4 Withdrawn Treatment Fabry's Disease 1 3 Completed Treatment Fabry's Disease 5
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Not Available
- Dosage Forms
Form Route Strength Injection, solution, concentrate Intravenous 1 MG/ML Solution Intravenous 1 mg / mL Solution, concentrate Intravenous 3.5 mg Solution Intravenous 1.0 mg/mL - Prices
- Not Available
- Patents
- Not Available
Properties
- State
- Liquid
- Experimental Properties
- Not Available
Targets
References
- Schaefer RM, Tylki-Szymanska A, Hilz MJ: Enzyme replacement therapy for Fabry disease: a systematic review of available evidence. Drugs. 2009 Nov 12;69(16):2179-205. doi: 10.2165/11318300-000000000-00000. [Article]
- El Dib RP, Pastores GM: Enzyme replacement therapy for Anderson-Fabry disease. Cochrane Database Syst Rev. 2010 May 12;(5):CD006663. doi: 10.1002/14651858.CD006663.pub2. [Article]
- Lim-Melia ER, Kronn DF: Current enzyme replacement therapy for the treatment of lysosomal storage diseases. Pediatr Ann. 2009 Aug;38(8):448-55. [Article]
- EMA Summary of Product Characteristics: Replagal Agalsidase Alfa Intravenous Injection [Link]
Transporters
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- Actions
- Substrate
- General Function
- Transmembrane signaling receptor activity
- Specific Function
- Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate r...
- Gene Name
- M6PR
- Uniprot ID
- P20645
- Uniprot Name
- Cation-dependent mannose-6-phosphate receptor
- Molecular Weight
- 30993.06 Da
References
- EMA Summary of Product Characteristics: Replagal Agalsidase Alfa Intravenous Injection [Link]
Drug created at September 22, 2020 14:49 / Updated at April 23, 2024 11:38