Thymidylate kinase
Details
- Name
- Thymidylate kinase
- Synonyms
- 2.7.4.9
- dTMP kinase
- Thymidine monophosphate kinase
- TMPK
- Gene Name
- tmk
- Organism
- Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
- Amino acid sequence
>lcl|BSEQ0051201|Thymidylate kinase MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLA SSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWV QRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYA ELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS
- Number of residues
- 214
- Molecular Weight
- 22634.285
- Theoretical pI
- Not Available
- GO Classification
- FunctionsATP binding / GTP binding / magnesium ion binding / protein homodimerization activity / thymidylate kinase activity / uridylate kinase activityProcessesdTDP biosynthetic process / dTTP biosynthetic process / dUDP biosynthetic process / TMP metabolic processComponentscytoplasm
- General Function
- Catalyzes the reversible phosphorylation of deoxythymidine monophosphate (dTMP) to deoxythymidine diphosphate (dTDP), using ATP as its preferred phosphoryl donor. Situated at the junction of both de novo and salvage pathways of deoxythymidine triphosphate (dTTP) synthesis, is essential for DNA synthesis and cellular growth. Has a broad specificity for nucleoside triphosphates, being highly active with ATP or dATP as phosphate donors, and less active with ITP, GTP, CTP and UTP.
- Specific Function
- Atp binding
- Pfam Domain Function
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0051202|Thymidylate kinase (tmk) GTGCTAATCGCGATTGAGGGCGTTGACGGCGCTGGCAAGCGGACGTTGGTGGAAAAGCTG TCCGGGGCCTTTCGAGCAGCCGGGAGATCGGTGGCCACACTGGCGTTCCCGCGCTACGGA CAGTCGGTGGCCGCCGACATCGCAGCGGAGGCGCTGCACGGCGAGCACGGTGACCTCGCA TCGTCGGTGTATGCGATGGCGACGCTGTTCGCGCTCGACCGCGCTGGCGCGGTCCACACG ATCCAGGGGCTGTGTCGCGGCTACGACGTGGTGATCCTGGATCGCTACGTCGCCTCCAAC GCGGCCTACAGCGCGGCGCGCCTACATGAAAACGCGGCCGGGAAGGCAGCGGCCTGGGTT CAGCGGATCGAATTTGCAAGACTCGGGTTGCCCAAGCCCGACTGGCAGGTGCTCCTTGCG GTCTCTGCCGAGCTCGCCGGGGAACGATCCCGCGGCCGTGCCCAGCGTGACCCCGGTCGG GCGCGCGACAATTACGAACGCGACGCTGAACTTCAGCAGCGCACCGGTGCGGTCTACGCC GAGTTGGCGGCCCAAGGGTGGGGCGGCCGGTGGCTGGTTGTCGGCGCCGATGTTGATCCG GGCCGACTAGCGGCGACTTTGGCGCCTCCAGACGTGCCAAGTTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P9WKE1 UniProtKB Entry Name KTHY_MYCTU - General References
- Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE 3rd, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BG: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature. 1998 Jun 11;393(6685):537-44. [Article]
- Munier-Lehmann H, Chaffotte A, Pochet S, Labesse G: Thymidylate kinase of Mycobacterium tuberculosis: a chimera sharing properties common to eukaryotic and bacterial enzymes. Protein Sci. 2001 Jun;10(6):1195-205. [Article]
- Li de la Sierra I, Munier-Lehmann H, Gilles AM, Barzu O, Delarue M: Crystallization and preliminary X-ray analysis of the thymidylate kinase from Mycobacterium tuberculosis. Acta Crystallogr D Biol Crystallogr. 2000 Feb;56(Pt 2):226-8. [Article]
- Raman K, Yeturu K, Chandra N: targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis. BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109. [Article]
- Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A: Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3. [Article]
- Li de la Sierra I, Munier-Lehmann H, Gilles AM, Barzu O, Delarue M: X-ray structure of TMP kinase from Mycobacterium tuberculosis complexed with TMP at 1.95 A resolution. J Mol Biol. 2001 Aug 3;311(1):87-100. [Article]
- Ursby T, Weik M, Fioravanti E, Delarue M, Goeldner M, Bourgeois D: Cryophotolysis of caged compounds: a technique for trapping intermediate states in protein crystals. Acta Crystallogr D Biol Crystallogr. 2002 Apr;58(Pt 4):607-14. Epub 2002 Mar 22. [Article]
- Haouz A, Vanheusden V, Munier-Lehmann H, Froeyen M, Herdewijn P, Van Calenbergh S, Delarue M: Enzymatic and structural analysis of inhibitors designed against Mycobacterium tuberculosis thymidylate kinase. New insights into the phosphoryl transfer mechanism. J Biol Chem. 2003 Feb 14;278(7):4963-71. Epub 2002 Nov 25. [Article]
- Fioravanti E, Haouz A, Ursby T, Munier-Lehmann H, Delarue M, Bourgeois D: Mycobacterium tuberculosis thymidylate kinase: structural studies of intermediates along the reaction pathway. J Mol Biol. 2003 Apr 11;327(5):1077-92. [Article]
- Fioravanti E, Adam V, Munier-Lehmann H, Bourgeois D: The crystal structure of Mycobacterium tuberculosis thymidylate kinase in complex with 3'-azidodeoxythymidine monophosphate suggests a mechanism for competitive inhibition. Biochemistry. 2005 Jan 11;44(1):130-7. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB01643 Thymidine monophosphate experimental unknown product of Details DB02452 Thymidine 5'-triphosphate experimental unknown Details DB03280 p1-(5'-adenosyl)p5-(5'-thymidyl)pentaphosphate experimental unknown ligand Details DB03666 Zidovudine monophosphate experimental unknown Details DB03846 2'-deoxy-5-(hydroxymethyl)uridine 5'-(dihydrogen phosphate) experimental unknown Details DB04485 Thymidine experimental, investigational unknown substrate Details