Apoptosis regulatory protein Siva
Details
- Name
- Apoptosis regulatory protein Siva
- Synonyms
- CD27-binding protein
- CD27BP
- SIVA
- Gene Name
- SIVA1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0009863|Apoptosis regulatory protein Siva MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDE GCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRA VDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET
- Number of residues
- 175
- Molecular Weight
- 18694.45
- Theoretical pI
- Not Available
- GO Classification
- FunctionsCD27 receptor binding / metal ion binding / virus receptor activity / zinc ion bindingProcessesactivation-induced cell death of T cells / extrinsic apoptotic signaling pathway / intrinsic apoptotic signaling pathway / negative regulation of NF-kappaB transcription factor activity / positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway / viral entry into host cellComponentscytoplasm / mitochondrion / nucleoplasm
- General Function
- Zinc ion binding
- Specific Function
- Induces CD27-mediated apoptosis. Inhibits BCL2L1 isoform Bcl-x(L) anti-apoptotic activity. Inhibits activation of NF-kappa-B and promotes T-cell receptor-mediated apoptosis.
- Pfam Domain Function
- Siva (PF05458)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0013957|Apoptosis regulatory protein Siva (SIVA1) ATGCCCAAGCGGAGCTGCCCCTTCGCGGACGTGGCCCCGCTACAGCTCAAGGTCCGCGTG AGCCAGAGGGAGTTGAGCCGCGGCGTGTGCGCCGAGCGCTACTCGCAGGAGGTCTTCGAG AAGACCAAGCGACTCCTGTTCCTCGGGGCCCAGGCCTACCTGGACCACGTGTGGGATGAA GGCTGTGCCGTCGTTCACCTGCCAGAGTCCCCAAAGCCTGGCCCTACAGGGGCCCCGAGG GCTGCACGTGGGCAGATGCTGATTGGACCAGACGGCCGCCTGATCAGGAGCCTTGGGCAG GCCTCCGAAGCTGACCCATCTGGGGTAGCGTCCATTGCCTGTTCCTCATGCGTGCGAGCC GTGGATGGGAAGGCGGTCTGCGGTCAGTGTGAGCGAGCCCTGTGCGGGCAGTGTGTGCGC ACCTGCTGGGGCTGCGGCTCCGTGGCCTGTACCCTGTGTGGCCTCGTGGACTGCAGTGAC ATGTACGAGAAAGTGCTGTGCACCAGCTGTGCCATGTTCGAGACCTGA
- Chromosome Location
- 14
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID O15304 UniProtKB Entry Name SIVA_HUMAN HGNC ID HGNC:17712 - General References
- Prasad KV, Ao Z, Yoon Y, Wu MX, Rizk M, Jacquot S, Schlossman SF: CD27, a member of the tumor necrosis factor receptor family, induces apoptosis and binds to Siva, a proapoptotic protein. Proc Natl Acad Sci U S A. 1997 Jun 10;94(12):6346-51. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Henke A, Launhardt H, Klement K, Stelzner A, Zell R, Munder T: Apoptosis in coxsackievirus B3-caused diseases: interaction between the capsid protein VP2 and the proapoptotic protein siva. J Virol. 2000 May;74(9):4284-90. [Article]
- Cao C, Ren X, Kharbanda S, Koleske AJ, Prasad KV, Kufe D: The ARG tyrosine kinase interacts with Siva-1 in the apoptotic response to oxidative stress. J Biol Chem. 2001 Apr 13;276(15):11465-8. Epub 2001 Feb 23. [Article]
- Henke A, Nestler M, Strunze S, Saluz HP, Hortschansky P, Menzel B, Martin U, Zell R, Stelzner A, Munder T: The apoptotic capability of coxsackievirus B3 is influenced by the efficient interaction between the capsid protein VP2 and the proapoptotic host protein Siva. Virology. 2001 Oct 10;289(1):15-22. [Article]
- Xue L, Chu F, Cheng Y, Sun X, Borthakur A, Ramarao M, Pandey P, Wu M, Schlossman SF, Prasad KV: Siva-1 binds to and inhibits BCL-X(L)-mediated protection against UV radiation-induced apoptosis. Proc Natl Acad Sci U S A. 2002 May 14;99(10):6925-30. [Article]
- Chu F, Borthakur A, Sun X, Barkinge J, Gudi R, Hawkins S, Prasad KV: The Siva-1 putative amphipathic helical region (SAH) is sufficient to bind to BCL-XL and sensitize cells to UV radiation induced apoptosis. Apoptosis. 2004 Jan;9(1):83-95. [Article]
- Py B, Slomianny C, Auberger P, Petit PX, Benichou S: Siva-1 and an alternative splice form lacking the death domain, Siva-2, similarly induce apoptosis in T lymphocytes via a caspase-dependent mitochondrial pathway. J Immunol. 2004 Apr 1;172(7):4008-17. [Article]
- Chu F, Barkinge J, Hawkins S, Gudi R, Salgia R, Kanteti PV: Expression of Siva-1 protein or its putative amphipathic helical region enhances cisplatin-induced apoptosis in breast cancer cells: effect of elevated levels of BCL-2. Cancer Res. 2005 Jun 15;65(12):5301-9. [Article]
- Nestler M, Martin U, Hortschansky P, Saluz HP, Henke A, Munder T: The zinc containing pro-apoptotic protein siva interacts with the peroxisomal membrane protein pmp22. Mol Cell Biochem. 2006 Jul;287(1-2):147-55. Epub 2006 May 9. [Article]
- Gudi R, Barkinge J, Hawkins S, Chu F, Manicassamy S, Sun Z, Duke-Cohan JS, Prasad KV: Siva-1 negatively regulates NF-kappaB activity: effect on T-cell receptor-mediated activation-induced cell death (AICD). Oncogene. 2006 Jun 8;25(24):3458-62. Epub 2006 Feb 20. [Article]
- Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB01593 Zinc approved, investigational unknown Details DB14487 Zinc acetate approved, investigational unknown Details DB14533 Zinc chloride approved, investigational unknown binder Details DB14548 Zinc sulfate, unspecified form approved, experimental unknown binder Details