Apoptosis regulatory protein Siva

Details

Name
Apoptosis regulatory protein Siva
Synonyms
  • CD27-binding protein
  • CD27BP
  • SIVA
Gene Name
SIVA1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0009863|Apoptosis regulatory protein Siva
MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDE
GCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRA
VDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET
Number of residues
175
Molecular Weight
18694.45
Theoretical pI
Not Available
GO Classification
Functions
CD27 receptor binding / metal ion binding / virus receptor activity / zinc ion binding
Processes
activation-induced cell death of T cells / extrinsic apoptotic signaling pathway / intrinsic apoptotic signaling pathway / negative regulation of NF-kappaB transcription factor activity / positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway / viral entry into host cell
Components
cytoplasm / mitochondrion / nucleoplasm
General Function
Zinc ion binding
Specific Function
Induces CD27-mediated apoptosis. Inhibits BCL2L1 isoform Bcl-x(L) anti-apoptotic activity. Inhibits activation of NF-kappa-B and promotes T-cell receptor-mediated apoptosis.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0013957|Apoptosis regulatory protein Siva (SIVA1)
ATGCCCAAGCGGAGCTGCCCCTTCGCGGACGTGGCCCCGCTACAGCTCAAGGTCCGCGTG
AGCCAGAGGGAGTTGAGCCGCGGCGTGTGCGCCGAGCGCTACTCGCAGGAGGTCTTCGAG
AAGACCAAGCGACTCCTGTTCCTCGGGGCCCAGGCCTACCTGGACCACGTGTGGGATGAA
GGCTGTGCCGTCGTTCACCTGCCAGAGTCCCCAAAGCCTGGCCCTACAGGGGCCCCGAGG
GCTGCACGTGGGCAGATGCTGATTGGACCAGACGGCCGCCTGATCAGGAGCCTTGGGCAG
GCCTCCGAAGCTGACCCATCTGGGGTAGCGTCCATTGCCTGTTCCTCATGCGTGCGAGCC
GTGGATGGGAAGGCGGTCTGCGGTCAGTGTGAGCGAGCCCTGTGCGGGCAGTGTGTGCGC
ACCTGCTGGGGCTGCGGCTCCGTGGCCTGTACCCTGTGTGGCCTCGTGGACTGCAGTGAC
ATGTACGAGAAAGTGCTGTGCACCAGCTGTGCCATGTTCGAGACCTGA
Chromosome Location
14
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO15304
UniProtKB Entry NameSIVA_HUMAN
HGNC IDHGNC:17712
General References
  1. Prasad KV, Ao Z, Yoon Y, Wu MX, Rizk M, Jacquot S, Schlossman SF: CD27, a member of the tumor necrosis factor receptor family, induces apoptosis and binds to Siva, a proapoptotic protein. Proc Natl Acad Sci U S A. 1997 Jun 10;94(12):6346-51. [Article]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  3. Henke A, Launhardt H, Klement K, Stelzner A, Zell R, Munder T: Apoptosis in coxsackievirus B3-caused diseases: interaction between the capsid protein VP2 and the proapoptotic protein siva. J Virol. 2000 May;74(9):4284-90. [Article]
  4. Cao C, Ren X, Kharbanda S, Koleske AJ, Prasad KV, Kufe D: The ARG tyrosine kinase interacts with Siva-1 in the apoptotic response to oxidative stress. J Biol Chem. 2001 Apr 13;276(15):11465-8. Epub 2001 Feb 23. [Article]
  5. Henke A, Nestler M, Strunze S, Saluz HP, Hortschansky P, Menzel B, Martin U, Zell R, Stelzner A, Munder T: The apoptotic capability of coxsackievirus B3 is influenced by the efficient interaction between the capsid protein VP2 and the proapoptotic host protein Siva. Virology. 2001 Oct 10;289(1):15-22. [Article]
  6. Xue L, Chu F, Cheng Y, Sun X, Borthakur A, Ramarao M, Pandey P, Wu M, Schlossman SF, Prasad KV: Siva-1 binds to and inhibits BCL-X(L)-mediated protection against UV radiation-induced apoptosis. Proc Natl Acad Sci U S A. 2002 May 14;99(10):6925-30. [Article]
  7. Chu F, Borthakur A, Sun X, Barkinge J, Gudi R, Hawkins S, Prasad KV: The Siva-1 putative amphipathic helical region (SAH) is sufficient to bind to BCL-XL and sensitize cells to UV radiation induced apoptosis. Apoptosis. 2004 Jan;9(1):83-95. [Article]
  8. Py B, Slomianny C, Auberger P, Petit PX, Benichou S: Siva-1 and an alternative splice form lacking the death domain, Siva-2, similarly induce apoptosis in T lymphocytes via a caspase-dependent mitochondrial pathway. J Immunol. 2004 Apr 1;172(7):4008-17. [Article]
  9. Chu F, Barkinge J, Hawkins S, Gudi R, Salgia R, Kanteti PV: Expression of Siva-1 protein or its putative amphipathic helical region enhances cisplatin-induced apoptosis in breast cancer cells: effect of elevated levels of BCL-2. Cancer Res. 2005 Jun 15;65(12):5301-9. [Article]
  10. Nestler M, Martin U, Hortschansky P, Saluz HP, Henke A, Munder T: The zinc containing pro-apoptotic protein siva interacts with the peroxisomal membrane protein pmp22. Mol Cell Biochem. 2006 Jul;287(1-2):147-55. Epub 2006 May 9. [Article]
  11. Gudi R, Barkinge J, Hawkins S, Chu F, Manicassamy S, Sun Z, Duke-Cohan JS, Prasad KV: Siva-1 negatively regulates NF-kappaB activity: effect on T-cell receptor-mediated activation-induced cell death (AICD). Oncogene. 2006 Jun 8;25(24):3458-62. Epub 2006 Feb 20. [Article]
  12. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownbinderDetails
DB14548Zinc sulfate, unspecified formapproved, experimentalunknownbinderDetails