Tumor protein p73
Details
- Name
- Tumor protein p73
- Synonyms
- p53-like transcription factor
- p53-related protein
- P73
- Gene Name
- TP73
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0049702|Tumor protein p73 MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTS VMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTD YPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPV YKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPY EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGR DRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRHGDEDTYYLQVR GRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGPVLSPMNKVHGG MNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSSHSAQSMVSGSH CTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMT IWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRG GPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH
- Number of residues
- 636
- Molecular Weight
- 69622.865
- Theoretical pI
- Not Available
- GO Classification
- Functionschromatin binding / damaged DNA binding / identical protein binding / MDM2/MDM4 family protein binding / metal ion binding / p53 binding / protein kinase binding / RNA polymerase II core promoter proximal region sequence-specific DNA binding / RNA polymerase II transcription factor activity, sequence-specific DNA binding / transcription factor activity, sequence-specific DNA binding / transcription factor binding / transcription regulatory region DNA binding / transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific bindingProcessesactivation of MAPK activity / cell cycle arrest / cellular response to DNA damage stimulus / cellular response to UV / DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator / intrinsic apoptotic signaling pathway in response to DNA damage / intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator / kidney development / mismatch repair / mitotic G1 DNA damage checkpoint / negative regulation of cardiac muscle cell proliferation / negative regulation of cell proliferation / negative regulation of JUN kinase activity / negative regulation of neuron apoptotic process / negative regulation of neuron differentiation / negative regulation of transcription from RNA polymerase II promoter / positive regulation of cell cycle arrest / positive regulation of oligodendrocyte differentiation / positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway / positive regulation of transcription from RNA polymerase II promoter / positive regulation of transcription, DNA-templated / protein tetramerization / regulation of apoptotic process / regulation of gene expression / regulation of mitotic cell cycle / regulation of signal transduction by p53 class mediator / response to drug / response to gamma radiation / response to organonitrogen compound / response to X-ray / viral processComponentscell junction / chromatin / cytosol / Golgi apparatus / intracellular membrane-bounded organelle / mitochondrion / nucleoplasm / nucleus / transcription factor complex
- General Function
- Participates in the apoptotic response to DNA damage. Isoforms containing the transactivation domain are pro-apoptotic, isoforms lacking the domain are anti-apoptotic and block the function of p53 and transactivating p73 isoforms. May be a tumor suppressor protein.
- Specific Function
- Chromatin binding
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Nucleus
- Gene sequence
>lcl|BSEQ0049703|Tumor protein p73 (TP73) ATGGCCCAGTCCACCGCCACCTCCCCTGATGGGGGCACCACGTTTGAGCACCTCTGGAGC TCTCTGGAACCAGACAGCACCTACTTCGACCTTCCCCAGTCAAGCCGGGGGAATAATGAG GTGGTGGGCGGAACGGATTCCAGCATGGACGTCTTCCACCTGGAGGGCATGACTACATCT GTCATGGCCCAGTTCAATCTGCTGAGCAGCACCATGGACCAGATGAGCAGCCGCGCGGCC TCGGCCAGCCCCTACACCCCAGAGCACGCCGCCAGCGTGCCCACCCACTCGCCCTACGCA CAACCCAGCTCCACCTTCGACACCATGTCGCCGGCGCCTGTCATCCCCTCCAACACCGAC TACCCCGGACCCCACCACTTTGAGGTCACTTTCCAGCAGTCCAGCACGGCCAAGTCAGCC ACCTGGACGTACTCCCCGCTCTTGAAGAAACTCTACTGCCAGATCGCCAAGACATGCCCC ATCCAGATCAAGGTGTCCACCCCGCCACCCCCAGGCACCGCCATCCGGGCCATGCCTGTT TACAAGAAAGCGGAGCACGTGACCGACGTCGTGAAACGCTGCCCCAACCACGAGCTCGGG AGGGACTTCAACGAAGGACAGTCTGCTCCAGCCAGCCACCTCATCCGCGTGGAAGGCAAT AATCTCTCGCAGTATGTGGATGACCCTGTCACCGGCAGGCAGAGCGTCGTGGTGCCCTAT GAGCCACCACAGGTGGGGACGGAATTCACCACCATCCTGTACAACTTCATGTGTAACAGC AGCTGTGTAGGGGGCATGAACCGGCGGCCCATCCTCATCATCATCACCCTGGAGATGCGG GATGGGCAGGTGCTGGGCCGCCGGTCCTTTGAGGGCCGCATCTGCGCCTGTCCTGGCCGC GACCGAAAAGCTGATGAGGACCACTACCGGGAGCAGCAGGCCCTGAACGAGAGCTCCGCC AAGAACGGGGCCGCCAGCAAGCGTGCCTTCAAGCAGAGCCCCCCTGCCGTCCCCGCCCTT GGTGCCGGTGTGAAGAAGCGGCGGCATGGAGACGAGGACACGTACTACCTTCAGGTGCGA GGCCGGGAGAACTTTGAGATCCTGATGAAGCTGAAAGAGAGCCTGGAGCTGATGGAGTTG GTGCCGCAGCCACTGGTGGACTCCTATCGGCAGCAGCAGCAGCTCCTACAGAGGCCGAGT CACCTACAGCCCCCGTCCTACGGGCCGGTCCTCTCGCCCATGAACAAGGTGCACGGGGGC ATGAACAAGCTGCCCTCCGTCAACCAGCTGGTGGGCCAGCCTCCCCCGCACAGTTCGGCA GCTACACCCAACCTGGGGCCCGTGGGCCCCGGGATGCTCAACAACCATGGCCACGCAGTG CCAGCCAACGGCGAGATGAGCAGCAGCCACAGCGCCCAGTCCATGGTCTCGGGGTCCCAC TGCACTCCGCCACCCCCCTACCACGCCGACCCCAGCCTCGTCAGTTTTTTAACAGGATTG GGGTGTCCAAACTGCATCGAGTATTTCACCTCCCAAGGGTTACAGAGCATTTACCACCTG CAGAACCTGACCATTGAGGACCTGGGGGCCCTGAAGATCCCCGAGCAGTACCGCATGACC ATCTGGCGGGGCCTGCAGGACCTGAAGCAGGGCCACGACTACAGCACCGCGCAGCAGCTG CTCCGCTCTAGCAACGCGGCCACCATCTCCATCGGCGGCTCAGGGGAACTGCAGCGCCAG CGGGTCATGGAGGCCGTGCACTTCCGCGTGCGCCACACCATCACCATCCCCAACCGCGGC GGCCCAGGCGGCGGCCCTGACGAGTGGGCGGACTTCGGCTTCGACCTGCCCGACTGCAAG GCCCGCAAGCAGCCCATCAAGGAGGAGTTCACGGAGGCCGAGATCCACTGA
- Chromosome Location
- 1
- Locus
- 1p36.32
- External Identifiers
Resource Link UniProtKB ID O15350 UniProtKB Entry Name P73_HUMAN HGNC ID HGNC:12003 - General References
- Kaghad M, Bonnet H, Yang A, Creancier L, Biscan JC, Valent A, Minty A, Chalon P, Lelias JM, Dumont X, Ferrara P, McKeon F, Caput D: Monoallelically expressed gene related to p53 at 1p36, a region frequently deleted in neuroblastoma and other human cancers. Cell. 1997 Aug 22;90(4):809-19. [Article]
- Mai M, Huang H, Reed C, Qian C, Smith JS, Alderete B, Jenkins R, Smith DI, Liu W: Genomic organization and mutation analysis of p73 in oligodendrogliomas with chromosome 1 p-arm deletions. Genomics. 1998 Aug 1;51(3):359-63. [Article]
- De Laurenzi V, Costanzo A, Barcaroli D, Terrinoni A, Falco M, Annicchiarico-Petruzzelli M, Levrero M, Melino G: Two new p73 splice variants, gamma and delta, with different transcriptional activity. J Exp Med. 1998 Nov 2;188(9):1763-8. [Article]
- De Laurenzi VD, Catani MV, Terrinoni A, Corazzari M, Melino G, Costanzo A, Levrero M, Knight RA: Additional complexity in p73: induction by mitogens in lymphoid cells and identification of two new splicing variants epsilon and zeta. Cell Death Differ. 1999 May;6(5):389-90. [Article]
- Yoshikawa H, Nagashima M, Khan MA, McMenamin MG, Hagiwara K, Harris CC: Mutational analysis of p73 and p53 in human cancer cell lines. Oncogene. 1999 Jun 3;18(22):3415-21. [Article]
- Grob TJ, Novak U, Maisse C, Barcaroli D, Luthi AU, Pirnia F, Hugli B, Graber HU, De Laurenzi V, Fey MF, Melino G, Tobler A: Human delta Np73 regulates a dominant negative feedback loop for TAp73 and p53. Cell Death Differ. 2001 Dec;8(12):1213-23. [Article]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
- Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Yuan ZM, Shioya H, Ishiko T, Sun X, Gu J, Huang YY, Lu H, Kharbanda S, Weichselbaum R, Kufe D: p73 is regulated by tyrosine kinase c-Abl in the apoptotic response to DNA damage. Nature. 1999 Jun 24;399(6738):814-7. [Article]
- Kaelin WG Jr: The emerging p53 gene family. J Natl Cancer Inst. 1999 Apr 7;91(7):594-8. [Article]
- Minty A, Dumont X, Kaghad M, Caput D: Covalent modification of p73alpha by SUMO-1. Two-hybrid screening with p73 identifies novel SUMO-1-interacting proteins and a SUMO-1 interaction motif. J Biol Chem. 2000 Nov 17;275(46):36316-23. [Article]
- Tsuji K, Mizumoto K, Yamochi T, Nishimoto I, Matsuoka M: Differential effect of ik3-1/cables on p53- and p73-induced cell death. J Biol Chem. 2002 Jan 25;277(4):2951-7. Epub 2001 Nov 12. [Article]
- Kim EJ, Park JS, Um SJ: Identification and characterization of HIPK2 interacting with p73 and modulating functions of the p53 family in vivo. J Biol Chem. 2002 Aug 30;277(35):32020-8. Epub 2002 Mar 29. [Article]
- Miyazaki K, Ozaki T, Kato C, Hanamoto T, Fujita T, Irino S, Watanabe K, Nakagawa T, Nakagawara A: A novel HECT-type E3 ubiquitin ligase, NEDL2, stabilizes p73 and enhances its transcriptional activity. Biochem Biophys Res Commun. 2003 Aug 15;308(1):106-13. [Article]
- Aqeilan RI, Pekarsky Y, Herrero JJ, Palamarchuk A, Letofsky J, Druck T, Trapasso F, Han SY, Melino G, Huebner K, Croce CM: Functional association between Wwox tumor suppressor protein and p73, a p53 homolog. Proc Natl Acad Sci U S A. 2004 Mar 30;101(13):4401-6. [Article]
- Kramer S, Ozaki T, Miyazaki K, Kato C, Hanamoto T, Nakagawara A: Protein stability and function of p73 are modulated by a physical interaction with RanBPM in mammalian cultured cells. Oncogene. 2005 Jan 27;24(5):938-44. [Article]
- Hoshino M, Qi ML, Yoshimura N, Miyashita T, Tagawa K, Wada Y, Enokido Y, Marubuchi S, Harjes P, Arai N, Oyanagi K, Blandino G, Sudol M, Rich T, Kanazawa I, Wanker EE, Saitoe M, Okazawa H: Transcriptional repression induces a slowly progressive atypical neuronal death associated with changes of YAP isoforms and p73. J Cell Biol. 2006 Feb 13;172(4):589-604. Epub 2006 Feb 6. [Article]
- Soond SM, Barry SP, Melino G, Knight RA, Latchman DS, Stephanou A: p73-mediated transcriptional activity is negatively regulated by polo-like kinase 1. Cell Cycle. 2008 May 1;7(9):1214-23. Epub 2008 Feb 15. [Article]
- Koida N, Ozaki T, Yamamoto H, Ono S, Koda T, Ando K, Okoshi R, Kamijo T, Omura K, Nakagawara A: Inhibitory role of Plk1 in the regulation of p73-dependent apoptosis through physical interaction and phosphorylation. J Biol Chem. 2008 Mar 28;283(13):8555-63. doi: 10.1074/jbc.M710608200. Epub 2008 Jan 3. [Article]
- Paliwal P, Radha V, Swarup G: Regulation of p73 by Hck through kinase-dependent and independent mechanisms. BMC Mol Biol. 2007 May 30;8:45. [Article]
- Levy D, Adamovich Y, Reuven N, Shaul Y: Yap1 phosphorylation by c-Abl is a critical step in selective activation of proapoptotic genes in response to DNA damage. Mol Cell. 2008 Feb 15;29(3):350-61. doi: 10.1016/j.molcel.2007.12.022. [Article]
- Sang M, Ando K, Okoshi R, Koida N, Li Y, Zhu Y, Shimozato O, Geng C, Shan B, Nakagawara A, Ozaki T: Plk3 inhibits pro-apoptotic activity of p73 through physical interaction and phosphorylation. Genes Cells. 2009 Jul;14(7):775-88. doi: 10.1111/j.1365-2443.2009.01309.x. Epub 2009 May 28. [Article]
- Peschiaroli A, Scialpi F, Bernassola F, Pagano M, Melino G: The F-box protein FBXO45 promotes the proteasome-dependent degradation of p73. Oncogene. 2009 Sep 3;28(35):3157-66. doi: 10.1038/onc.2009.177. Epub 2009 Jul 6. [Article]
- Wu H, Zeinab RA, Flores ER, Leng RP: Pirh2, a ubiquitin E3 ligase, inhibits p73 transcriptional activity by promoting its ubiquitination. Mol Cancer Res. 2011 Dec;9(12):1780-90. doi: 10.1158/1541-7786.MCR-11-0157. Epub 2011 Oct 12. [Article]
- Sahu SK, Mohanty S, Kumar A, Kundu CN, Verma SC, Choudhuri T: Epstein-Barr virus nuclear antigen 3C interact with p73: Interplay between a viral oncoprotein and cellular tumor suppressor. Virology. 2014 Jan 5;448:333-43. doi: 10.1016/j.virol.2013.10.023. Epub 2013 Nov 12. [Article]
- Chi SW, Ayed A, Arrowsmith CH: Solution structure of a conserved C-terminal domain of p73 with structural homology to the SAM domain. EMBO J. 1999 Aug 16;18(16):4438-45. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB01593 Zinc approved, investigational unknown cofactor Details DB14487 Zinc acetate approved, investigational unknown Details DB14533 Zinc chloride approved, investigational unknown chaperone Details DB14548 Zinc sulfate, unspecified form approved, experimental unknown chaperone Details