N(G),N(G)-dimethylarginine dimethylaminohydrolase 2

Details

Name
N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
Synonyms
  • 3.5.3.18
  • DDAH
  • DDAH-2
  • DDAHII
  • Dimethylargininase-2
  • G6A
  • NG30
  • Protein G6a
  • S-phase protein
Gene Name
DDAH2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0021264|N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQL
LELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEIGDE
NATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVSGPSHLRGLCGMGG
PRTVVAGSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLRPGLPGVPPFLLHRGGG
DLPNSQEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVLSTRPHS
Number of residues
285
Molecular Weight
29643.54
Theoretical pI
5.9
GO Classification
Functions
amino acid binding / catalytic activity / dimethylargininase activity
Processes
arginine catabolic process / citrulline metabolic process / negative regulation of apoptotic process / nitric oxide biosynthetic process / nitric oxide mediated signal transduction / nitric oxide metabolic process / positive regulation of nitric oxide biosynthetic process / regulation of nitric-oxide synthase activity / small molecule metabolic process
Components
centrosome / cytoplasm / cytosol / extracellular exosome / mitochondrion
General Function
Dimethylargininase activity
Specific Function
Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0021265|N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 (DDAH2)
ATGGGGACGCCGGGGGAGGGGCTGGGCCGCTGCTCCCATGCCCTGATCCGGGGAGTCCCA
GAGAGCCTGGCGTCGGGGGAAGGTGCGGGGGCTGGCCTTCCCGCTCTGGATCTGGCCAAA
GCTCAAAGGGAGCACGGGGTGCTGGGAGGTAAACTGAGGCAACGACTGGGGCTACAGCTG
CTAGAACTGCCACCTGAGGAGTCATTGCCGCTGGGACCGCTGCTTGGCGACACGGCCGTG
ATCCAAGGGGACACGGCCCTAATCACGCGGCCCTGGAGCCCCGCTCGTAGGCCAGAGGTC
GATGGAGTCCGCAAAGCCCTGCAAGACCTGGGGCTCCGAATTGTGGAAATAGGAGACGAG
AACGCGACGCTGGATGGCACTGACGTTCTCTTCACCGGCCGGGAGTTTTTCGTAGGCCTC
TCCAAATGGACCAATCACCGAGGAGCTGAGATCGTGGCGGACACGTTCCGGGACTTCGCC
GTCTCCACTGTGCCAGTCTCGGGTCCCTCCCACCTGCGCGGTCTCTGCGGCATGGGGGGA
CCTCGCACTGTTGTGGCAGGCAGCAGCGACGCTGCCCAAAAGGCTGTCCGGGCAATGGCA
GTGCTGACAGATCACCCATATGCCTCCCTGACCCTCCCAGATGACGCAGCTGCTGACTGT
CTCTTTCTTCGTCCTGGGTTGCCTGGTGTGCCCCCTTTCCTCCTGCACCGTGGAGGTGGG
GATCTGCCCAACAGCCAGGAGGCACTGCAGAAGCTCTCTGATGTCACCCTGGTACCTGTG
TCCTGCTCAGAACTGGAGAAGGCTGGCGCCGGGCTCAGCTCCCTCTGCTTGGTGCTCAGC
ACACGCCCCCACAGCTGA
Chromosome Location
6
Locus
6p21.3
External Identifiers
ResourceLink
UniProtKB IDO95865
UniProtKB Entry NameDDAH2_HUMAN
GenBank Protein ID4454710
GenBank Gene IDAF070667
GenAtlas IDDDAH2
HGNC IDHGNC:2716
General References
  1. Leiper JM, Santa Maria J, Chubb A, MacAllister RJ, Charles IG, Whitley GS, Vallance P: Identification of two human dimethylarginine dimethylaminohydrolases with distinct tissue distributions and homology with microbial arginine deiminases. Biochem J. 1999 Oct 1;343 Pt 1:209-14. [Article]
  2. Zhang QH, Ye M, Wu XY, Ren SX, Zhao M, Zhao CJ, Fu G, Shen Y, Fan HY, Lu G, Zhong M, Xu XR, Han ZG, Zhang JW, Tao J, Huang QH, Zhou J, Hu GX, Gu J, Chen SJ, Chen Z: Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells. Genome Res. 2000 Oct;10(10):1546-60. [Article]
  3. Ribas G, Neville M, Wixon JL, Cheng J, Campbell RD: Genes encoding three new members of the leukocyte antigen 6 superfamily and a novel member of Ig superfamily, together with genes encoding the regulatory nuclear chloride ion channel protein (hRNCC) and an N omega-N omega-dimethylarginine dimethylaminohydrolase homologue, are found in a 30-kb segment of the MHC class III region. J Immunol. 1999 Jul 1;163(1):278-87. [Article]
  4. Xie T, Rowen L, Aguado B, Ahearn ME, Madan A, Qin S, Campbell RD, Hood L: Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse. Genome Res. 2003 Dec;13(12):2621-36. [Article]
  5. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [Article]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  7. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
  8. Cillero-Pastor B, Mateos J, Fernandez-Lopez C, Oreiro N, Ruiz-Romero C, Blanco FJ: Dimethylarginine dimethylaminohydrolase 2, a newly identified mitochondrial protein modulating nitric oxide synthesis in normal human chondrocytes. Arthritis Rheum. 2012 Jan;64(1):204-12. doi: 10.1002/art.30652. [Article]
  9. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00155Citrullineinvestigational, nutraceuticalunknownDetails