Rubredoxin
Details
- Name
- Rubredoxin
- Synonyms
- Rd
- Gene Name
- rub
- Organism
- Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303)
- Amino acid sequence
>lcl|BSEQ0017322|Rubredoxin MKKYVCTVCGYEYDPAEGDPDNGVKPGTSFDDLPADWVCPVCGAPKSEFEAA
- Number of residues
- 52
- Molecular Weight
- 5574.145
- Theoretical pI
- 3.87
- GO Classification
- Functionselectron carrier activity / iron ion bindingProcessesoxidation-reduction processComponentscytoplasm
- General Function
- Iron ion binding
- Specific Function
- Rubredoxin is a small nonheme, iron protein lacking acid-labile sulfide. Its single Fe, chelated to 4 Cys, functions as an electron acceptor and may also stabilize the conformation of the molecule.Electron acceptor for cytoplasmic lactate dehydrogenase.
- Pfam Domain Function
- Rubredoxin (PF00301)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0017323|Rubredoxin (rub) ATGAAAAAGTACGTATGCACCGTCTGCGGTTACGAATACGACCCTGCTGAAGGCGACCCC GACAACGGCGTGAAGCCCGGCACCTCGTTCGACGACCTGCCGGCCGACTGGGTATGCCCC GTGTGCGGCGCCCCCAAGAGCGAATTCGAAGCCGCCTAG
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P00269 UniProtKB Entry Name RUBR_DESVH GenBank Protein ID 758676 GenBank Gene ID M28848 - General References
- Brumlik MJ, Voordouw G: Analysis of the transcriptional unit encoding the genes for rubredoxin (rub) and a putative rubredoxin oxidoreductase (rbo) in Desulfovibrio vulgaris Hildenborough. J Bacteriol. 1989 Sep;171(9):4996-5004. [Article]
- Voordouw G: Cloning of genes encoding redox proteins of known amino acid sequence from a library of the Desulfovibrio vulgaris (Hildenborough) genome. Gene. 1988 Jul 15;67(1):75-83. [Article]
- Bruschi M: Non-heme iron proteins. The amino acid sequence of rubredoxin from Desulfovibrio vulgaris. Biochim Biophys Acta. 1976 May 20;434(1):4-17. [Article]
- Heidelberg JF, Seshadri R, Haveman SA, Hemme CL, Paulsen IT, Kolonay JF, Eisen JA, Ward N, Methe B, Brinkac LM, Daugherty SC, Deboy RT, Dodson RJ, Durkin AS, Madupu R, Nelson WC, Sullivan SA, Fouts D, Haft DH, Selengut J, Peterson JD, Davidsen TM, Zafar N, Zhou L, Radune D, Dimitrov G, Hance M, Tran K, Khouri H, Gill J, Utterback TR, Feldblyum TV, Wall JD, Voordouw G, Fraser CM: The genome sequence of the anaerobic, sulfate-reducing bacterium Desulfovibrio vulgaris Hildenborough. Nat Biotechnol. 2004 May;22(5):554-9. Epub 2004 Apr 11. [Article]
- Adman ET, Sieker LC, Jensen LH, Bruschi M, Le Gall J: A structural model of rubredoxin from Desulfovibrio vulgaris at 2 A resolution. J Mol Biol. 1977 May 5;112(1):113-20. [Article]
- Adman ET, Sieker LC, Jensen LH: Structure of rubredoxin from Desulfovibrio vulgaris at 1.5 A resolution. J Mol Biol. 1991 Jan 20;217(2):337-52. [Article]