Corticoliberin
Details
- Name
- Corticoliberin
- Synonyms
- Corticotropin-releasing factor
- Corticotropin-releasing hormone
- CRF
- Gene Name
- CRH
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0016286|Corticoliberin MRLPLLVSAGVLLVALLPCPPCRALLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQ ARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLL LPRRSLDSPAALAERGARNALGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQL AQQAHSNRKLMEIIGK
- Number of residues
- 196
- Molecular Weight
- 21421.505
- Theoretical pI
- 10.55
- GO Classification
- Functionshormone activity / neuropeptide hormone activity / receptor bindingProcessesadrenal gland development / associative learning / cellular response to cocaine / cellular response to dexamethasone stimulus / diterpenoid metabolic process / female pregnancy / glucocorticoid biosynthetic process / hormone-mediated apoptotic signaling pathway / hypothalamus development / inflammatory response / ion homeostasis / learning or memory / locomotory exploration behavior / long-term synaptic potentiation / lung development / negative regulation of blood pressure / negative regulation of cell death / negative regulation of circadian sleep/wake cycle, REM sleep / negative regulation of epinephrine secretion / negative regulation of gene expression / negative regulation of glucagon secretion / negative regulation of luteinizing hormone secretion / negative regulation of norepinephrine secretion / parturition / positive regulation of behavioral fear response / positive regulation of calcium ion import / positive regulation of cAMP biosynthetic process / positive regulation of cell death / positive regulation of cell proliferation / positive regulation of circadian sleep/wake cycle, wakefulness / positive regulation of corticosterone secretion / positive regulation of corticotropin secretion / positive regulation of cortisol secretion / positive regulation of digestive system process / positive regulation of gene expression / positive regulation of insulin secretion involved in cellular response to glucose stimulus / positive regulation of protein phosphorylation / regulation of N-methyl-D-aspartate selective glutamate receptor activity / regulation of serotonin secretion / response to corticosterone / response to drug / response to estrogen / response to ethanol / response to ether / response to immobilization stress / response to pain / signal transduction / synaptic transmission / synaptic transmission, dopaminergicComponentscytoplasm / extracellular region / extracellular space / perikaryon / varicosity
- General Function
- Receptor binding
- Specific Function
- Hormone regulating the release of corticotropin from pituitary gland (By similarity). Induces NLRP6 in intestinal epithelial cells, hence may influence gut microbiota profile (By similarity).
- Pfam Domain Function
- CRF (PF00473)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0016287|Corticoliberin (CRH) ATGCGGCTGCCGCTGCTTGTGTCCGCGGGAGTCCTGCTGGTGGCTCTCCTGCCCTGCCCG CCATGCAGGGCGCTCCTGAGCCGCGGGCCGGTCCCGGGAGCTCGGCAGGCGCCGCAGCAC CCTCAGCCCTTGGATTTCTTCCAGCCGCCGCCGCAGTCCGAGCAGCCCCAGCAGCCGCAG GCTCGGCCGGTCCTGCTCCGCATGGGAGAGGAGTACTTCCTCCGCCTGGGGAACCTCAAC AAGAGCCCGGCCGCTCCCCTTTCGCCCGCCTCCTCGCTCCTCGCCGGAGGCAGCGGCAGC CGCCCTTCGCCGGAACAGGCGACCGCCAACTTTTTCCGCGTGTTGCTGCAGCAGCTGCTG CTGCCTCGGCGCTCGCTCGACAGCCCCGCGGCTCTCGCGGAGCGCGGCGCTAGGAATGCC CTCGGCGGCCACCAGGAGGCACCGGAGAGAGAAAGGCGGTCCGAGGAGCCTCCCATCTCC CTGGATCTCACCTTCCACCTCCTCCGGGAAGTCTTGGAAATGGCCAGGGCCGAGCAGTTA GCACAGCAAGCTCACAGCAACAGGAAACTCATGGAGATTATTGGGAAATAA
- Chromosome Location
- 8
- Locus
- 8q13
- External Identifiers
Resource Link UniProtKB ID P06850 UniProtKB Entry Name CRF_HUMAN GenBank Protein ID 35356 GenBank Gene ID V00571 GenAtlas ID CRH HGNC ID HGNC:2355 - General References
- Shibahara S, Morimoto Y, Furutani Y, Notake M, Takahashi H, Shimizu S, Horikawa S, Numa S: Isolation and sequence analysis of the human corticotropin-releasing factor precursor gene. EMBO J. 1983;2(5):775-9. [Article]
- Robinson BG, D'Angio LA Jr, Pasieka KB, Majzoub JA: Preprocorticotropin releasing hormone: cDNA sequence and in vitro processing. Mol Cell Endocrinol. 1989 Feb;61(2):175-80. [Article]
- Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T: Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. DNA Res. 2005;12(2):117-26. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Sasaki A, Tempst P, Liotta AS, Margioris AN, Hood LE, Kent SB, Sato S, Shinkawa O, Yoshinaga K, Krieger DT: Isolation and characterization of a corticotropin-releasing hormone-like peptide from human placenta. J Clin Endocrinol Metab. 1988 Oct;67(4):768-73. [Article]
- Romier C, Bernassau JM, Cambillau C, Darbon H: Solution structure of human corticotropin releasing factor by 1H NMR and distance geometry with restrained molecular dynamics. Protein Eng. 1993 Feb;6(2):149-56. [Article]
- Pioszak AA, Parker NR, Suino-Powell K, Xu HE: Molecular recognition of corticotropin-releasing factor by its G-protein-coupled receptor CRFR1. J Biol Chem. 2008 Nov 21;283(47):32900-12. doi: 10.1074/jbc.M805749200. Epub 2008 Sep 17. [Article]