Fatty acid-binding protein, liver
Details
- Name
- Fatty acid-binding protein, liver
- Synonyms
- FABPL
- Fatty acid-binding protein 1
- L-FABP
- Liver-type fatty acid-binding protein
- Gene Name
- FABP1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0012785|Fatty acid-binding protein, liver MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQ NEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVF KRISKRI
- Number of residues
- 127
- Molecular Weight
- 14208.34
- Theoretical pI
- 7.37
- GO Classification
- Functionsantioxidant activity / bile acid binding / chromatin binding / drug binding / fatty acid binding / long-chain fatty acid transporter activity / phospholipid bindingProcessescellular lipid metabolic process / cellular response to hydrogen peroxide / cellular response to hypoxia / intestinal absorption / mitophagy in response to mitochondrial depolarization / negative regulation of apoptotic process / negative regulation of cysteine-type endopeptidase activity involved in apoptotic process / positive regulation of cell proliferation / positive regulation of defense response to virus by host / positive regulation of fatty acid beta-oxidation / positive regulation of hydrolase activity / small molecule metabolic process / triglyceride catabolic process / xenophagyComponentsapical cortex / cytoplasm / cytosol / extracellular exosome / nucleoplasm / peroxisomal matrix
- General Function
- Phospholipid binding
- Specific Function
- Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PubMed:25732850). Binds cholesterol (PubMed:25732850). Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport (By similarity).
- Pfam Domain Function
- Lipocalin (PF00061)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0012786|Fatty acid-binding protein, liver (FABP1) ATGAGTTTCTCCGGCAAGTACCAACTGCAGAGCCAGGAAAACTTTGAAGCCTTCATGAAG GCAATCGGTCTGCCGGAAGAGCTCATCCAGAAGGGGAAGGATATCAAGGGGGTGTCGGAA ATCGTGCAGAATGGGAAGCACTTCAAGTTCACCATCACCGCTGGGTCCAAAGTGATCCAA AACGAATTCACGGTGGGGGAGGAATGTGAGCTGGAGACAATGACAGGGGAGAAAGTCAAG ACAGTGGTTCAGTTGGAAGGTGACAATAAACTGGTGACAACTTTCAAAAACATCAAGTCT GTGACCGAACTCAACGGCGACATAATCACCAATACCATGACATTGGGTGACATTGTCTTC AAGAGAATCAGCAAGAGAATTTAA
- Chromosome Location
- 2
- Locus
- 2p11
- External Identifiers
Resource Link UniProtKB ID P07148 UniProtKB Entry Name FABPL_HUMAN GenBank Protein ID 182358 GenBank Gene ID M10617 HGNC ID HGNC:3555 - General References
- Chan L, Wei CF, Li WH, Yang CY, Ratner P, Pownall H, Gotto AM Jr, Smith LC: Human liver fatty acid binding protein cDNA and amino acid sequence. Functional and evolutionary implications. J Biol Chem. 1985 Mar 10;260(5):2629-32. [Article]
- Lowe JB, Boguski MS, Sweetser DA, Elshourbagy NA, Taylor JM, Gordon JI: Human liver fatty acid binding protein. Isolation of a full length cDNA and comparative sequence analyses of orthologous and paralogous proteins. J Biol Chem. 1985 Mar 25;260(6):3413-7. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
- Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
- Huang H, McIntosh AL, Landrock KK, Landrock D, Storey SM, Martin GG, Gupta S, Atshaves BP, Kier AB, Schroeder F: Human FABP1 T94A variant enhances cholesterol uptake. Biochim Biophys Acta. 2015 Jul;1851(7):946-55. doi: 10.1016/j.bbalip.2015.02.015. Epub 2015 Feb 27. [Article]
- Xu Y, Long D, Yang D: Rapid data collection for protein structure determination by NMR spectroscopy. J Am Chem Soc. 2007 Jun 27;129(25):7722-3. Epub 2007 May 31. [Article]