Photosynthetic reaction center cytochrome c subunit
Details
- Name
- Photosynthetic reaction center cytochrome c subunit
- Synonyms
- cytC
- Cytochrome c558/c559
- Gene Name
- pufC
- Organism
- Blastochloris viridis
- Amino acid sequence
>lcl|BSEQ0012687|Photosynthetic reaction center cytochrome c subunit MKQLIVNSVATVALASLVAGCFEPPPATTTQTGFRGLSMGEVLHPATVKAKKERDAQYPP ALAAVKAEGPPVSQVYKNVKVLGNLTEAEFLRTMTAITEWVSPQEGCTYCHDENNLASEA KYPYVVARRMLEMTRAINTNWTQHVAQTGVTCYTCHRGTPLPPYVRYLEPTLPLNNRETP THVERVETRSGYVVRLAKYTAYSALNYDPFTMFLANDKRQVRVVPQTALPLVGVSRGKER RPLSDAYATFALMMSISDSLGTNCTFCHNAQTFESWGKKSTPQRAIAWWGIRMVRDLNMN YLAPLNASLPASRLGRQGEAPQADCRTCHQGVTKPLFGASRLKDYPELGPIKAAAK
- Number of residues
- 356
- Molecular Weight
- 39370.915
- Theoretical pI
- 9.51
- GO Classification
- Functionselectron carrier activity / heme binding / iron ion bindingProcessesoxidation-reduction process / photosynthesis, light reactionComponentsplasma membrane / plasma membrane light-harvesting complex
- General Function
- Iron ion binding
- Specific Function
- The reaction center of purple bacteria contains a tightly bound cytochrome molecule which re-reduces the photo oxidized primary electron donor.
- Pfam Domain Function
- CytoC_RC (PF02276)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cell membrane
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P07173 UniProtKB Entry Name CYCR_BLAVI GenBank Protein ID 758274 GenBank Gene ID X05768 - General References
- Weyer KA, Lottspeich F, Gruenberg H, Lang F, Oesterhelt D, Michel H: Amino acid sequence of the cytochrome subunit of the photosynthetic reaction centre from the purple bacterium Rhodopseudomonas viridis. EMBO J. 1987 Aug;6(8):2197-202. [Article]
- Deisenhofer J, Epp O, Miki K, Huber R, Michel H: X-ray structure analysis of a membrane protein complex. Electron density map at 3 A resolution and a model of the chromophores of the photosynthetic reaction center from Rhodopseudomonas viridis. J Mol Biol. 1984 Dec 5;180(2):385-98. [Article]
- Lancaster CR, Michel H: The coupling of light-induced electron transfer and proton uptake as derived from crystal structures of reaction centres from Rhodopseudomonas viridis modified at the binding site of the secondary quinone, QB. Structure. 1997 Oct 15;5(10):1339-59. [Article]
- Lancaster CR, Michel H: Refined crystal structures of reaction centres from Rhodopseudomonas viridis in complexes with the herbicide atrazine and two chiral atrazine derivatives also lead to a new model of the bound carotenoid. J Mol Biol. 1999 Feb 26;286(3):883-98. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB07392 Atrazine experimental unknown Details DB07551 (2S)-2-{[4-chloro-6-(ethylamino)-1,3,5-triazin-2-yl]amino}-2-methylbutanenitrile experimental unknown Details DB07552 (2R)-2-{[4-chloro-6-(ethylamino)-1,3,5-triazin-2-yl]amino}-2-methylbutanenitrile experimental unknown Details DB04464 N-Formylmethionine experimental unknown Details DB04147 Dodecyldimethylamine N-oxide experimental unknown Details DB08215 Terbutryn experimental unknown Details DB08689 Ubiquinone Q1 experimental unknown Details DB08690 Ubiquinone Q2 experimental unknown Details