Neocarzinostatin
Details
- Name
- Neocarzinostatin
- Synonyms
- Mitomalcin
- MMC
- NCS
- Gene Name
- ncsA
- Organism
- Streptomyces carzinostaticus
- Amino acid sequence
>lcl|BSEQ0017324|Neocarzinostatin MVPISIIRNRVAKVAVGSAAVLGLAVGFQTPAVAAAPTATVTPSSGLSDGTVVKVAGAGL QAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTV DCTTAACQVGLSDAAGNGPEGVAISFN
- Number of residues
- 147
- Molecular Weight
- 14455.08
- Theoretical pI
- 4.34
- GO Classification
- FunctionsDNA bindingProcessesdefense response to bacterium
- General Function
- NCS has antibiotic activity (for Gram-positive bacteria) and antitumor activity (for certain mouse tumors). NCS binds non-covalently to a chromophore which is the cytotoxic and mutagenic component of the antibiotic. The chromophore binds to DNA as a weak intercalator and causes single- and double-strand breaks.
- Specific Function
- Dna binding
- Pfam Domain Function
- Neocarzinostat (PF00960)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasmic
- Gene sequence
>lcl|BSEQ0007788|444 bp GTGGTCCCCATTTCCATCATCAGGAATCGAGTAGCGAAGGTCGCCGTCGGCTCGGCGGCG GTGCTGGGGCTCGCCGTAGGGTTCCAGACCCCGGCCGTGGCCGCGGCGCCGACGGCTACG GTGACTCCGTCGTCCGGTCTGTCCGACGGCACCGTGGTCAAGGTCGCCGGCGCGGGTCTC CAGGCCGGAACGGCCTACGACGTCGGGCAGTGCGCGTGGGTGGACACCGGTGTTCTCGCG TGCAACCCGGCGGACTTCTCCTCCGTGACCGCGGACGCCAACGGCTCCGCGAGCACGTCG CTGACGGTGCGCCGCTCCTTCGAGGGCTTCCTCTTCGACGGCACCCGCTGGGGCACCGTG GACTGCACCACCGCGGCCTGCCAGGTCGGCCTCTCGGACGCTGCGGGCAACGGCCCGGAG GGTGTGGCGATCTCCTTCAACTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0A3R9 UniProtKB Entry Name NCZS_STRCZ GenBank Protein ID 398596 GenBank Gene ID D10996 - General References
- Sakata N, Minamitani S, Kanbe T, Hori M, Hamada M, Edo K: The amino acid sequence of neocarzinostatin apoprotein deduced from the base sequence of the gene. Biol Pharm Bull. 1993 Jan;16(1):26-8. [Article]
- Kuromizu K, Tsunasawa S, Maeda H, Abe O, Sakiyama F: Reexamination of the primary structure of an antitumor protein, neocarzinostatin. Arch Biochem Biophys. 1986 Apr;246(1):199-205. [Article]
- Gibson BW, Herlihy WC, Samy TS, Hahm KS, Maeda H, Meienhofer J, Biemann K: A revised primary structure for neocarzinostatin based on fast atom bombardment and gas chromatographic-mass spectrometry. J Biol Chem. 1984 Sep 10;259(17):10801-6. [Article]
- Gao XL, Burkhart W: Two- and three-dimensional proton NMR studies of apo-neocarzinostatin. Biochemistry. 1991 Aug 6;30(31):7730-9. [Article]
- Teplyakov A, Obmolova G, Wilson K, Kuromizu K: Crystal structure of apo-neocarzinostatin at 0.15-nm resolution. Eur J Biochem. 1993 Apr 15;213(2):737-41. [Article]
- Kim KH, Kwon BM, Myers AG, Rees DC: Crystal structure of neocarzinostatin, an antitumor protein-chromophore complex. Science. 1993 Nov 12;262(5136):1042-6. [Article]
- Gao X: Three-dimensional solution structure of apo-neocarzinostatin. J Mol Biol. 1992 May 5;225(1):125-35. [Article]
- Adjadj E, Mispelter J, Quiniou E, Dimicoli JL, Favaudon V, Lhoste JM: Proton NMR studies of apo-neocarzinostatin from Streptomyces carzinostaticus. Sequence-specific assignment and secondary structure. Eur J Biochem. 1990 Jun 20;190(2):263-71. [Article]
- Adjadj E, Quiniou E, Mispelter J, Favaudon V, Lhoste JM: Three-dimensional solution structure of apo-neocarzinostatin from Streptomyces carzinostaticus determined by NMR spectroscopy. Eur J Biochem. 1992 Feb 1;203(3):505-11. [Article]
- Remerowski ML, Glaser SJ, Sieker LC, Samy TS, Drobny GP: Sequential 1H NMR assignments and secondary structure of aponeocarzinostatin in solution. Biochemistry. 1990 Sep 11;29(36):8401-9. [Article]
- Takashima H, Amiya S, Kobayashi Y: Neocarzinostatin: interaction between the antitumor-active chromophore and the carrier protein. J Biochem. 1991 Jun;109(6):807-10. [Article]
- Kuromizu K, Abe O, Maeda H: Location of the disulfide bonds in the antitumor protein neocarzinostatin. Arch Biochem Biophys. 1991 May 1;286(2):569-73. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB07776 Flavone approved, experimental unknown Details DB08261 2-hydroxy-7-methoxy-5-methyl-naphthalene-1-carboxylic acid meso-2,5-dihydroxy-cyclopent-3-enyl ester experimental unknown Details DB08619 Testosterone succinate experimental unknown Details