30S ribosomal protein S19

Details

Name
30S ribosomal protein S19
Synonyms
Not Available
Gene Name
rpsS
Organism
Escherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0017194|30S ribosomal protein S19
MPRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPV
FVTDEMVGHKLGEFAPTRTYRGHAADKKAKKK
Number of residues
92
Molecular Weight
10430.235
Theoretical pI
11.27
GO Classification
Functions
poly(A) RNA binding / rRNA binding / structural constituent of ribosome / tRNA binding
Processes
ribosomal small subunit assembly / translation
Components
cytosol / cytosolic small ribosomal subunit
General Function
Trna binding
Specific Function
In the E.coli 70S ribosome in the initiation state (PubMed:12809609) it has been modeled to contact the 23S rRNA of the 50S subunit forming part of bridge B1a; this bridge is broken in the model with bound EF-G. The 23S rRNA contact site in bridge B1a is modeled to differ in different ribosomal states (PubMed:12859903), contacting alternately S13 or S19. In the 3.5 angstroms resolved ribosome structures (PubMed:16272117) the contacts between L5, S13 and S19 bridge B1b are different, confirming the dynamic nature of this interaction. Bridge B1a is not visible in the crystallized ribosomes due to 23S rRNA disorder.Protein S19 forms a complex with S13 that binds strongly to the 16S ribosomal RNA. Contacts the A site tRNA.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0017195|30S ribosomal protein S19 (rpsS)
ATGCCACGTTCTCTCAAGAAAGGTCCTTTTATTGACCTGCACTTGCTGAAGAAGGTAGAG
AAAGCGGTGGAAAGCGGAGACAAGAAGCCCCTGCGCACTTGGTCCCGTCGTTCAACGATC
TTTCCTAACATGATCGGTTTGACCATCGCTGTCCATAATGGTCGTCAGCACGTTCCGGTA
TTTGTAACCGACGAAATGGTTGGTCACAAACTGGGTGAATTCGCACCGACTCGTACTTAT
CGCGGCCACGCTGCTGATAAAAAAGCGAAGAAGAAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0A7U3
UniProtKB Entry NameRS19_ECOLI
GenBank Protein ID42826
GenBank Gene IDX02613
General References
  1. Zurawski G, Zurawski SM: Structure of the Escherichia coli S10 ribosomal protein operon. Nucleic Acids Res. 1985 Jun 25;13(12):4521-6. [Article]
  2. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
  3. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
  4. Yaguchi M, Wittmann HG: Primary structure of protein S19 from the small ribosomal subunit of Escherichia coli. FEBS Lett. 1978 Apr 15;88(2):227-30. [Article]
  5. Pohl T, Wittmann-Liebold B: Identification of a cross-link in the Escherichia coli ribosomal protein pair S13-S19 at the amino acid level. J Biol Chem. 1988 Mar 25;263(9):4293-301. [Article]
  6. Osswald M, Doring T, Brimacombe R: The ribosomal neighbourhood of the central fold of tRNA: cross-links from position 47 of tRNA located at the A, P or E site. Nucleic Acids Res. 1995 Nov 25;23(22):4635-41. [Article]
  7. Lovgren JM, Bylund GO, Srivastava MK, Lundberg LA, Persson OP, Wingsle G, Wikstrom PM: The PRC-barrel domain of the ribosome maturation protein RimM mediates binding to ribosomal protein S19 in the 30S ribosomal subunits. RNA. 2004 Nov;10(11):1798-812. [Article]
  8. Arnold RJ, Reilly JP: Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry. Anal Biochem. 1999 Apr 10;269(1):105-12. [Article]
  9. Tung CS, Joseph S, Sanbonmatsu KY: All-atom homology model of the Escherichia coli 30S ribosomal subunit. Nat Struct Biol. 2002 Oct;9(10):750-5. [Article]
  10. Gao H, Sengupta J, Valle M, Korostelev A, Eswar N, Stagg SM, Van Roey P, Agrawal RK, Harvey SC, Sali A, Chapman MS, Frank J: Study of the structural dynamics of the E coli 70S ribosome using real-space refinement. Cell. 2003 Jun 13;113(6):789-801. [Article]
  11. Valle M, Zavialov A, Sengupta J, Rawat U, Ehrenberg M, Frank J: Locking and unlocking of ribosomal motions. Cell. 2003 Jul 11;114(1):123-34. [Article]
  12. Schuwirth BS, Borovinskaya MA, Hau CW, Zhang W, Vila-Sanjurjo A, Holton JM, Cate JH: Structures of the bacterial ribosome at 3.5 A resolution. Science. 2005 Nov 4;310(5749):827-34. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00560TigecyclineapprovedyesbinderDetails
DB00759Tetracyclineapproved, vet_approved, withdrawnyesinhibitorDetails
DB09093Chlortetracyclineapproved, investigational, vet_approvedyesinhibitorDetails
DB12455Omadacyclineapproved, investigationalyesinhibitorDetails