30S ribosomal protein S9

Details

Name
30S ribosomal protein S9
Synonyms
Not Available
Gene Name
rpsI
Organism
Escherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0009951|30S ribosomal protein S9
MAENQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEK
LDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRK
ARRRPQFSKR
Number of residues
130
Molecular Weight
14856.105
Theoretical pI
11.52
GO Classification
Functions
structural constituent of ribosome / tRNA binding
Processes
translation
Components
cytosol / cytosolic small ribosomal subunit
General Function
Trna binding
Specific Function
The C-terminal tail plays a role in the affinity of the 30S P site for different tRNAs. Mutations that decrease this affinity are suppressed in the 70S ribosome.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0009952|30S ribosomal protein S9 (rpsI)
ATGGCTGAAAATCAATACTACGGCACTGGTCGCCGCAAAAGTTCCGCAGCTCGCGTTTTC
ATCAAACCGGGCAACGGTAAAATCGTAATCAACCAACGTTCTCTGGAACAGTACTTCGGT
CGTGAAACTGCCCGCATGGTAGTTCGTCAGCCGCTGGAACTGGTCGACATGGTTGAGAAA
CTGGACCTGTACATCACCGTTAAAGGTGGTGGTATCTCTGGTCAGGCTGGTGCGATCCGT
CACGGTATCACCCGCGCTCTGATGGAATACGACGAGTCCCTGCGTTCTGAACTGCGTAAA
GCTGGCTTCGTTACTCGTGACGCTCGTCAGGTTGAACGTAAGAAAGTCGGTCTGCGTAAA
GCACGTCGTCGTCCGCAGTTCTCCAAACGTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0A7X3
UniProtKB Entry NameRS9_ECOLI
GenBank Protein ID535073
GenBank Gene IDX02130
General References
  1. Isono S, Thamm S, Kitakawa M, Isono K: Cloning and nucleotide sequencing of the genes for ribosomal proteins S9 (rpsI) and L13 (rplM) of Escherichia coli. Mol Gen Genet. 1985;198(2):279-82. [Article]
  2. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
  3. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
  4. Chen R, Wittmann-Liebold B: The primary structure of protein S9 from the 30S subunit of Escherichia coli ribosomes. FEBS Lett. 1975 Mar 15;52(1):139-40. [Article]
  5. Urlaub H, Kruft V, Bischof O, Muller EC, Wittmann-Liebold B: Protein-rRNA binding features and their structural and functional implications in ribosomes as determined by cross-linking studies. EMBO J. 1995 Sep 15;14(18):4578-88. [Article]
  6. Marsh RC, Parmeggiani A: Requirement of proteins S5 and S9 from 30S subunits for the ribosome-dependent GTPase activity of elongation factor G. Proc Natl Acad Sci U S A. 1973 Jan;70(1):151-5. [Article]
  7. Osswald M, Doring T, Brimacombe R: The ribosomal neighbourhood of the central fold of tRNA: cross-links from position 47 of tRNA located at the A, P or E site. Nucleic Acids Res. 1995 Nov 25;23(22):4635-41. [Article]
  8. VanBogelen RA, Abshire KZ, Moldover B, Olson ER, Neidhardt FC: Escherichia coli proteome analysis using the gene-protein database. Electrophoresis. 1997 Aug;18(8):1243-51. [Article]
  9. Hoang L, Fredrick K, Noller HF: Creating ribosomes with an all-RNA 30S subunit P site. Proc Natl Acad Sci U S A. 2004 Aug 24;101(34):12439-43. Epub 2004 Aug 12. [Article]
  10. Arnold RJ, Reilly JP: Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry. Anal Biochem. 1999 Apr 10;269(1):105-12. [Article]
  11. Tung CS, Joseph S, Sanbonmatsu KY: All-atom homology model of the Escherichia coli 30S ribosomal subunit. Nat Struct Biol. 2002 Oct;9(10):750-5. [Article]
  12. Gao H, Sengupta J, Valle M, Korostelev A, Eswar N, Stagg SM, Van Roey P, Agrawal RK, Harvey SC, Sali A, Chapman MS, Frank J: Study of the structural dynamics of the E coli 70S ribosome using real-space refinement. Cell. 2003 Jun 13;113(6):789-801. [Article]
  13. Schuwirth BS, Borovinskaya MA, Hau CW, Zhang W, Vila-Sanjurjo A, Holton JM, Cate JH: Structures of the bacterial ribosome at 3.5 A resolution. Science. 2005 Nov 4;310(5749):827-34. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00453ClomocyclineexperimentalunknowninhibitorDetails
DB00560TigecyclineapprovedyesbinderDetails
DB00595Oxytetracyclineapproved, investigational, vet_approvedyesinhibitorDetails
DB01017Minocyclineapproved, investigationalyesinhibitorDetails
DB01301RolitetracyclineapprovedyesinhibitorDetails