Purine nucleoside phosphorylase DeoD-type
Details
- Name
- Purine nucleoside phosphorylase DeoD-type
- Synonyms
- 2.4.2.1
- Inosine phosphorylase
- PNP
- pup
- Gene Name
- deoD
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0016645|Purine nucleoside phosphorylase DeoD-type MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISV MGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIR FKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVE MEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLGDKE
- Number of residues
- 239
- Molecular Weight
- 25949.68
- Theoretical pI
- 5.35
- GO Classification
- Functionsidentical protein binding / purine-nucleoside phosphorylase activityProcessescellular response to DNA damage stimulus / purine nucleoside catabolic process / purine nucleoside interconversionComponentscytosol / membrane
- General Function
- Purine-nucleoside phosphorylase activity
- Specific Function
- Cleavage of guanosine or inosine to respective bases and sugar-1-phosphate molecules.
- Pfam Domain Function
- PNP_UDP_1 (PF01048)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0016646|Purine nucleoside phosphorylase DeoD-type (deoD) ATGGCTACCCCACACATTAATGCAGAAATGGGCGATTTCGCTGACGTAGTTTTGATGCCA GGCGACCCGCTGCGTGCGAAGTATATTGCTGAAACTTTCCTTGAAGATGCCCGTGAAGTG AACAACGTTCGCGGTATGCTGGGCTTCACCGGTACTTACAAAGGCCGCAAAATTTCCGTA ATGGGTCACGGTATGGGTATCCCGTCCTGCTCCATCTACACCAAAGAACTGATCACCGAT TTCGGCGTGAAGAAAATTATCCGCGTGGGTTCCTGTGGCGCAGTTCTGCCGCACGTAAAA CTGCGCGACGTCGTTATCGGTATGGGTGCCTGCACCGATTCCAAAGTTAACCGCATCCGT TTTAAAGACCATGACTTTGCCGCTATCGCTGACTTCGACATGGTGCGTAACGCAGTAGAT GCAGCTAAAGCACTGGGTATTGATGCTCGCGTGGGTAACCTGTTCTCCGCTGACCTGTTC TACTCTCCGGACGGCGAAATGTTCGACGTGATGGAAAAATACGGCATTCTCGGCGTGGAA ATGGAAGCGGCTGGTATCTACGGCGTCGCTGCAGAATTTGGCGCGAAAGCCCTGACCATC TGCACCGTATCTGACCACATCCGCACTCACGAGCAGACCACTGCCGCTGAGCGTCAGACT ACCTTCAACGACATGATCAAAATCGCACTGGAATCCGTTCTGCTGGGCGATAAAGAGTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0ABP8 UniProtKB Entry Name DEOD_ECOLI GenBank Protein ID 147309 GenBank Gene ID M60917 - General References
- Hershfield MS, Chaffee S, Koro-Johnson L, Mary A, Smith AA, Short SA: Use of site-directed mutagenesis to enhance the epitope-shielding effect of covalent modification of proteins with polyethylene glycol. Proc Natl Acad Sci U S A. 1991 Aug 15;88(16):7185-9. [Article]
- Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL, Blattner FR: Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes. Nucleic Acids Res. 1995 Jun 25;23(12):2105-19. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Henzel WJ, Billeci TM, Stults JT, Wong SC, Grimley C, Watanabe C: Identifying proteins from two-dimensional gels by molecular mass searching of peptide fragments in protein sequence databases. Proc Natl Acad Sci U S A. 1993 Jun 1;90(11):5011-5. [Article]
- Larsen JE, Albrechtsen B, Valentin-Hansen P: Analysis of the terminator region after the deoCABD operon of Escherichia coli K-12 using a new class of single copy number operon-fusion vectors. Nucleic Acids Res. 1987 Jul 10;15(13):5125-40. [Article]
- Zhang J, Sprung R, Pei J, Tan X, Kim S, Zhu H, Liu CF, Grishin NV, Zhao Y: Lysine acetylation is a highly abundant and evolutionarily conserved modification in Escherichia coli. Mol Cell Proteomics. 2009 Feb;8(2):215-25. doi: 10.1074/mcp.M800187-MCP200. Epub 2008 Aug 23. [Article]
- Mao C, Cook WJ, Zhou M, Koszalka GW, Krenitsky TA, Ealick SE: The crystal structure of Escherichia coli purine nucleoside phosphorylase: a comparison with the human enzyme reveals a conserved topology. Structure. 1997 Oct 15;5(10):1373-83. [Article]
- Koellner G, Luic M, Shugar D, Saenger W, Bzowska A: Crystal structure of the ternary complex of E. coli purine nucleoside phosphorylase with formycin B, a structural analogue of the substrate inosine, and phosphate (Sulphate) at 2.1 A resolution. J Mol Biol. 1998 Jul 3;280(1):153-66. [Article]
- Koellner G, Bzowska A, Wielgus-Kutrowska B, Luic M, Steiner T, Saenger W, Stepinski J: Open and closed conformation of the E. coli purine nucleoside phosphorylase active center and implications for the catalytic mechanism. J Mol Biol. 2002 Jan 18;315(3):351-71. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB02066 N7-Methyl-Formycin A experimental unknown Details DB02113 6-Methylpurine experimental unknown Details DB02896 Methylthioinosine experimental unknown Details DB02934 9-(6-deoxy-alpha-L-talofuranosyl)-6-methylpurine experimental unknown Details DB02947 2-Fluoro-2'-Deoxyadenosine experimental unknown Details DB03172 Tubercidin experimental unknown Details DB03528 9-Beta-D-Xylofuranosyl-Adenine experimental unknown Details DB03735 9-(2-Deoxy-Beta-D-Ribofuranosyl)-6-Methylpurine experimental unknown Details DB03952 9-(6-deoxy-beta-D-allofuranosyl)-6-methylpurine experimental unknown Details DB03986 6-methyl-formycin A experimental unknown Details DB04198 Formycin B experimental unknown Details DB04441 2-Fluoroadenosine experimental unknown Details DB04335 Inosine experimental, investigational unknown Details