Serum amyloid A-1 protein
Details
- Name
- Serum amyloid A-1 protein
- Synonyms
- SAA
- Gene Name
- SAA1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0020799|Serum amyloid A-1 protein MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNY DAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPE KY
- Number of residues
- 122
- Molecular Weight
- 13531.885
- Theoretical pI
- 6.79
- GO Classification
- Functionschemoattractant activity / G-protein coupled receptor binding / heparin bindingProcessesactivation of MAPK activity / acute-phase response / cellular protein metabolic process / innate immune response / lymphocyte chemotaxis / macrophage chemotaxis / negative regulation of inflammatory response / neutrophil chemotaxis / platelet activation / positive chemotaxis / positive regulation of cell adhesion / positive regulation of cytokine secretion / positive regulation of cytosolic calcium ion concentration / positive regulation of interleukin-1 secretion / receptor-mediated endocytosis / regulation of protein secretionComponentscytoplasmic microtubule / cytosol / endocytic vesicle lumen / extracellular exosome / extracellular region / extracellular space / high-density lipoprotein particle
- General Function
- Heparin binding
- Specific Function
- Major acute phase protein.
- Pfam Domain Function
- SAA (PF00277)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0020800|Serum amyloid A-1 protein (SAA1) ATGAAGCTTCTCACGGGCCTGGTTTTCTGCTCCTTGGTCCTGGGTGTCAGCAGCCGAAGC TTCTTTTCGTTCCTTGGCGAGGCTTTTGATGGGGCTCGGGACATGTGGAGAGCCTACTCT GACATGAGAGAAGCCAATTACATCGGCTCAGACAAATACTTCCATGCTCGGGGGAACTAT GATGCTGCCAAAAGGGGACCTGGGGGTGCCTGGGCTGCAGAAGTGATCAGCGATGCCAGA GAGAATATCCAGAGATTCTTTGGCCATGGTGCGGAGGACTCGCTGGCTGATCAGGCTGCC AATGAATGGGGCAGGAGTGGCAAAGACCCCAATCACTTCCGACCTGCTGGCCTGCCTGAG AAATACTGA
- Chromosome Location
- 11
- Locus
- 11p15.1
- External Identifiers
Resource Link UniProtKB ID P0DJI8 UniProtKB Entry Name SAA1_HUMAN GenBank Protein ID 337748 GenBank Gene ID M10906 GenAtlas ID SAA1 HGNC ID HGNC:10513 - General References
- Sipe JD, Colten HR, Goldberger G, Edge MD, Tack BF, Cohen AS, Whitehead AS: Human serum amyloid A (SAA): biosynthesis and postsynthetic processing of preSAA and structural variants defined by complementary DNA. Biochemistry. 1985 Jun 4;24(12):2931-6. [Article]
- Kluve-Beckerman B, Dwulet FE, Benson MD: Human serum amyloid A. Three hepatic mRNAs and the corresponding proteins in one person. J Clin Invest. 1988 Nov;82(5):1670-5. [Article]
- Betts JC, Edbrooke MR, Thakker RV, Woo P: The human acute-phase serum amyloid A gene family: structure, evolution and expression in hepatoma cells. Scand J Immunol. 1991 Oct;34(4):471-82. [Article]
- Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Steinkasserer A, Weiss EH, Schwaeble W, Linke RP: Heterogeneity of human serum amyloid A protein. Five different variants from one individual demonstrated by cDNA sequence analysis. Biochem J. 1990 May 15;268(1):187-93. [Article]
- Parmelee DC, Titani K, Ericsson LH, Eriksen N, Benditt EP, Walsh KA: Amino acid sequence of amyloid-related apoprotein (apoSAA1) from human high-density lipoprotein. Biochemistry. 1982 Jul 6;21(14):3298-303. [Article]
- Beach CM, De Beer MC, Sipe JD, Loose LD, De Beer FC: Human serum amyloid A protein. Complete amino acid sequence of a new variant. Biochem J. 1992 Mar 1;282 ( Pt 2):615-20. [Article]
- Moyner K, Sletten K, Husby G, Natvig JB: An unusually large (83 amino acid residues) amyloid fibril protein AA from a patient with Waldenstrom's macroglobulinaemia and amyloidosis. Scand J Immunol. 1980;11(5):549-54. [Article]
- Ein D, Kimura S, Terry WD, Magnotta J, Glenner GG: Amino acid sequence of an amyloid fibril protein of unknown origin. J Biol Chem. 1972 Sep 10;247(17):5653-5. [Article]
- Levin M, Franklin EC, Frangione B, Pras M: The amino acid sequence of a major nonimmunoglobulin component of some amyloid fibrils. J Clin Invest. 1972 Oct;51(10):2773-6. [Article]
- Sletten K, Husby G: The complete amino-acid sequence of non-immunoglobulin amyloid fibril protein AS in rheumatoid arthritis. Eur J Biochem. 1974 Jan 3;41(1):117-25. [Article]
- Baba S, Takahashi T, Kasama T, Shirasawa H: Identification of two novel amyloid A protein subsets coexisting in an individual patient of AA-amyloidosis. Biochim Biophys Acta. 1992 Dec 10;1180(2):195-200. [Article]
- Sletten K, Husby G, Natvig JB: The complete amino acid sequence of an amyloid fibril protein AA1 of unusual size (64 residues). Biochem Biophys Res Commun. 1976 Mar 8;69(1):19-25. [Article]
- Benditt EP, Eriksen N, Hermodson MA, Ericsson LH: The major proteins of human and monkey amyloid substance: Common properties including unusual N-terminal amino acid sequences. FEBS Lett. 1971 Dec 1;19(2):169-173. [Article]
- Prelli F, Pras M, Frangione B: Degradation and deposition of amyloid AA fibrils are tissue specific. Biochemistry. 1987 Dec 15;26(25):8251-6. [Article]
- Howard BA, Wang MZ, Campa MJ, Corro C, Fitzgerald MC, Patz EF Jr: Identification and validation of a potential lung cancer serum biomarker detected by matrix-assisted laser desorption/ionization-time of flight spectra analysis. Proteomics. 2003 Sep;3(9):1720-4. [Article]
- Ducret A, Bruun CF, Bures EJ, Marhaug G, Husby G, Aebersold R: Characterization of human serum amyloid A protein isoforms separated by two-dimensional electrophoresis by liquid chromatography/electrospray ionization tandem mass spectrometry. Electrophoresis. 1996 May;17(5):866-76. [Article]
- Westermark P, Sletten K, Westermark GT, Raynes J, McAdam KP: A protein AA-variant derived from a novel serum AA protein, SAA1 delta, in an individual from Papua New Guinea. Biochem Biophys Res Commun. 1996 Jun 14;223(2):320-3. [Article]
- Sipe J: Revised nomenclature for serum amyloid A (SAA). Nomenclature Committee of the International Society of Amyloidosis. Part 2. Amyloid. 1999 Mar;6(1):67-70. [Article]
- Kiernan UA, Tubbs KA, Nedelkov D, Niederkofler EE, Nelson RW: Detection of novel truncated forms of human serum amyloid A protein in human plasma. FEBS Lett. 2003 Feb 27;537(1-3):166-70. [Article]
- Baba S, Takahashi T, Kasama T, Fujie M, Shirasawa H: A novel polymorphism of human serum amyloid A protein, SAA1 gamma, is characterized by alanines at both residues 52 and 57. Arch Biochem Biophys. 1993 Jun;303(2):361-6. [Article]
- Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
- Lu J, Yu Y, Zhu I, Cheng Y, Sun PD: Structural mechanism of serum amyloid A-mediated inflammatory amyloidosis. Proc Natl Acad Sci U S A. 2014 Apr 8;111(14):5189-94. doi: 10.1073/pnas.1322357111. Epub 2014 Mar 24. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details