Glycerol-3-phosphate cytidylyltransferase

Details

Name
Glycerol-3-phosphate cytidylyltransferase
Synonyms
  • 2.7.7.39
  • CDP-glycerol pyrophosphorylase
  • GCT
  • Teichoic acid biosynthesis protein D
Gene Name
tagD
Organism
Bacillus subtilis (strain 168)
Amino acid sequence
>lcl|BSEQ0019152|Glycerol-3-phosphate cytidylyltransferase
MKKVITYGTFDLLHWGHIKLLERAKQLGDYLVVAISTDEFNLQKQKKAYHSYEHRKLILE
TIRYVDEVIPEKNWEQKKQDIIDHNIDVFVMGDDWEGKFDFLKDQCEVVYLPRTEGISTT
KIKEEIAGL
Number of residues
129
Molecular Weight
15271.45
Theoretical pI
6.01
GO Classification
Functions
glycerol-3-phosphate cytidylyltransferase activity / metal ion binding
Processes
cell wall organization / teichoic acid biosynthetic process
Components
cytoplasm
General Function
Metal ion binding
Specific Function
Provides activated glycerol phosphate for teichoic acid synthesis, via incorporation into both the linkage unit and the teichoic acid polymer by TagB and TagF.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0019153|Glycerol-3-phosphate cytidylyltransferase (tagD)
ATGAAAAAAGTTATCACATATGGAACTTTTGATTTACTGCATTGGGGTCACATTAAATTG
CTTGAGCGTGCAAAGCAGCTTGGTGATTATTTAGTTGTTGCTATTTCAACGGATGAATTC
AATTTACAAAAGCAAAAAAAAGCTTATCACAGCTATGAGCACCGTAAATTAATTTTAGAA
ACCATTCGATATGTGGACGAAGTAATTCCTGAAAAGAATTGGGAGCAAAAAAAGCAAGAT
ATTATTGATCATAATATTGATGTTTTTGTTATGGGGGATGACTGGGAAGGTAAATTTGAC
TTTCTCAAAGATCAGTGTGAGGTTGTTTACCTCCCAAGAACAGAAGGCATCTCTACAACA
AAGATCAAAGAGGAAATTGCTGGTTTATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP27623
UniProtKB Entry NameTAGD_BACSU
GenBank Protein ID143723
GenBank Gene IDM57497
General References
  1. Mauel C, Young M, Karamata D: Genes concerned with synthesis of poly(glycerol phosphate), the essential teichoic acid in Bacillus subtilis strain 168, are organized in two divergent transcription units. J Gen Microbiol. 1991 Apr;137(4):929-41. [Article]
  2. Park YS, Sweitzer TD, Dixon JE, Kent C: Expression, purification, and characterization of CTP:glycerol-3-phosphate cytidylyltransferase from Bacillus subtilis. J Biol Chem. 1993 Aug 5;268(22):16648-54. [Article]
  3. Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A: The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997 Nov 20;390(6657):249-56. [Article]
  4. Park YS, Gee P, Sanker S, Schurter EJ, Zuiderweg ER, Kent C: Identification of functional conserved residues of CTP:glycerol-3-phosphate cytidylyltransferase. Role of histidines in the conserved HXGH in catalysis. J Biol Chem. 1997 Jun 13;272(24):15161-6. [Article]
  5. Sanker S, Campbell HA, Kent C: Negative cooperativity of substrate binding but not enzyme activity in wild-type and mutant forms of CTP:glycerol-3-phosphate cytidylyltransferase. J Biol Chem. 2001 Oct 12;276(41):37922-8. Epub 2001 Aug 3. [Article]
  6. Howell A, Dubrac S, Andersen KK, Noone D, Fert J, Msadek T, Devine K: Genes controlled by the essential YycG/YycF two-component system of Bacillus subtilis revealed through a novel hybrid regulator approach. Mol Microbiol. 2003 Sep;49(6):1639-55. [Article]
  7. Weber CH, Park YS, Sanker S, Kent C, Ludwig ML: A prototypical cytidylyltransferase: CTP:glycerol-3-phosphate cytidylyltransferase from bacillus subtilis. Structure. 1999 Sep 15;7(9):1113-24. [Article]
  8. Pattridge KA, Weber CH, Friesen JA, Sanker S, Kent C, Ludwig ML: Glycerol-3-phosphate cytidylyltransferase. Structural changes induced by binding of CDP-glycerol and the role of lysine residues in catalysis. J Biol Chem. 2003 Dec 19;278(51):51863-71. Epub 2003 Sep 23. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02431Cytidine-5'-TriphosphateexperimentalunknownDetails
DB02484Cytidine 5'-diphosphoglycerolexperimentalunknownDetails