Neuraminidase
Details
- Name
- Neuraminidase
- Synonyms
- 3.2.1.18
- Gene Name
- NA
- Organism
- Influenza B virus (strain B/Beijing/1/1987)
- Amino acid sequence
>lcl|BSEQ0012456|Neuraminidase MLPSTIQTLTLFLTSGGVLLSLYVSASLSYLLYSDILLKFSSKITAPTMTLDCANASNVQ AVNRSATKEMTFLLPEPEWTYPRLSCQGSTFQKALLISPHRFGEARGNSAPLIIREPFIA CGPKECKHFALTHYAAQPGGYYNGTREDRNKLRHLISVKLGKIPTVENSIFHMAAWSGSA CHDGREWTYIGVDGPDSNALIKIKYGEAYTDTYHSYANNILRTQESACNCIGGDCYLMIT DGSASGISKCRFLKIREGRIIKEIFPTGRVEHTEECTCGFASNKTIECACRDNSYTAKRP FVKLNVETDTAEIRLMCTETYLDTPRPDDGSITGPCESNGDKGRGGIKGGFVHQRMASKI GRWYSRTMSKTERMGMELYVRYDGDPWTDSDALAHSGVMVSMKEPGWYSFGFEIKDKKCD VPCIGIEMVHDGGKKTWHSAATAIYCLMGSGQLLWDTVTGVDMAL
- Number of residues
- 465
- Molecular Weight
- 51429.21
- Theoretical pI
- 7.55
- GO Classification
- Functionsexo-alpha-(2->3)-sialidase activity / exo-alpha-(2->6)-sialidase activity / exo-alpha-(2->8)-sialidase activity / metal ion bindingProcessescarbohydrate metabolic processComponentshost cell plasma membrane / integral component of membrane / virion membrane
- General Function
- Metal ion binding
- Specific Function
- Catalyzes the removal of terminal sialic acid residues from viral and cellular glycoconjugates. Cleaves off the terminal sialic acids on the glycosylated HA during virus budding to facilitate virus release. Additionally helps virus spread through the circulation by further removing sialic acids from the cell surface. These cleavages prevent self-aggregation and ensure the efficient spread of the progeny virus from cell to cell. Otherwise, infection would be limited to one round of replication. Described as a receptor-destroying enzyme because it cleaves a terminal sialic acid from the cellular receptors. May facilitate viral invasion of the upper airways by cleaving the sialic acid moities on the mucin of the airway epithelial cells (By similarity).
- Pfam Domain Function
- Neur (PF00064)
- Transmembrane Regions
- 7-35
- Cellular Location
- Virion membrane
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P27907 UniProtKB Entry Name NRAM_INBBE GenBank Gene ID M54967 - General References
- Burmeister WP, Daniels RS, Dayan S, Gagnon J, Cusack S, Ruigrok RW: Sequence and crystallization of influenza virus B/Beijing/1/87 neuraminidase. Virology. 1991 Jan;180(1):266-72. [Article]
- Moscona A: Neuraminidase inhibitors for influenza. N Engl J Med. 2005 Sep 29;353(13):1363-73. [Article]
- Burmeister WP, Ruigrok RW, Cusack S: The 2.2 A resolution crystal structure of influenza B neuraminidase and its complex with sialic acid. EMBO J. 1992 Jan;11(1):49-56. [Article]
- Taylor NR, Cleasby A, Singh O, Skarzynski T, Wonacott AJ, Smith PW, Sollis SL, Howes PD, Cherry PC, Bethell R, Colman P, Varghese J: Dihydropyrancarboxamides related to zanamivir: a new series of inhibitors of influenza virus sialidases. 2. Crystallographic and molecular modeling study of complexes of 4-amino-4H-pyran-6-carboxamides and sialidase from influenza virus types A and B. J Med Chem. 1998 Mar 12;41(6):798-807. [Article]