Lantibiotic nisin-Z
Details
- Name
- Lantibiotic nisin-Z
- Synonyms
- Not Available
- Gene Name
- nisZ
- Organism
- Lactococcus lactis subsp. lactis
- Amino acid sequence
>lcl|BSEQ0017325|Lantibiotic nisin-Z MSTKDFNLDLVSVSKKDSGASPRITSISLCTPGCKTGALMGCNMKTATCNCSIHVSK
- Number of residues
- 57
- Molecular Weight
- 5939.87
- Theoretical pI
- 8.8
- GO Classification
- Processescytolysis / defense response to bacteriumComponentsextracellular region
- General Function
- Not Available
- Specific Function
- Lanthionine-containing peptide antibiotic (lantibiotic) active on Gram-positive bacteria. The bactericidal activity of lantibiotics is based on depolarization of energized bacterial cytoplasmic membranes, initiated by the formation of aqueous transmembrane pores.
- Pfam Domain Function
- Gallidermin (PF02052)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0007808|174 bp ATGAGTACAAAAGATTTTAACTTGGATTTGGTATCTGTTTCGAAGAAAGATTCAGGTGCA TCACCACGCATTACAAGTATTTCGCTATGTACACCCGGTTGTAAAACAGGAGCTCTGATG GGTTGTAACATGAAAACAGCAACTTGTAATTGTAGTATTCACGTAAGCAAATAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P29559 UniProtKB Entry Name LANZ_LACLL GenBank Protein ID 44047 GenBank Gene ID X61144 - General References
- Mulders JW, Boerrigter IJ, Rollema HS, Siezen RJ, de Vos WM: Identification and characterization of the lantibiotic nisin Z, a natural nisin variant. Eur J Biochem. 1991 Nov 1;201(3):581-4. [Article]
- Immonen T, Ye S, Ra R, Qiao M, Paulin L, Saris PE: The codon usage of the nisZ operon in Lactococcus lactis N8 suggests a non-lactococcal origin of the conjugative nisin-sucrose transposon. DNA Seq. 1995;5(4):203-18. [Article]
- Hsu ST, Breukink E, Tischenko E, Lutters MA, de Kruijff B, Kaptein R, Bonvin AM, van Nuland NA: The nisin-lipid II complex reveals a pyrophosphate cage that provides a blueprint for novel antibiotics. Nat Struct Mol Biol. 2004 Oct;11(10):963-7. Epub 2004 Sep 12. [Article]