Glial cell line-derived neurotrophic factor
Details
- Name
- Glial cell line-derived neurotrophic factor
- Synonyms
- Astrocyte-derived trophic factor
- ATF
- hGDNF
- Gene Name
- GDNF
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0004882|Glial cell line-derived neurotrophic factor MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQ FDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVL TAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCR PIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
- Number of residues
- 211
- Molecular Weight
- 23719.85
- Theoretical pI
- 9.34
- GO Classification
- Functionsprotein homodimerization activity / receptor bindingProcessesadult locomotory behavior / axon guidance / branching involved in ureteric bud morphogenesis / enteric nervous system development / mesenchymal to epithelial transition involved in metanephros morphogenesis / metanephros development / mRNA stabilization / negative regulation of apoptotic process / negative regulation of extrinsic apoptotic signaling pathway in absence of ligand / negative regulation of neuron apoptotic process / nervous system development / neural crest cell migration / neuron projection development / organ induction / peristalsis / positive regulation of branching involved in ureteric bud morphogenesis / positive regulation of cell differentiation / positive regulation of cell proliferation / positive regulation of dopamine secretion / positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis / positive regulation of monooxygenase activity / positive regulation of transcription from RNA polymerase II promoter / positive regulation of ureteric bud formation / postganglionic parasympathetic fiber development / postsynaptic membrane organization / regulation of dopamine uptake involved in synaptic transmission / regulation of gene expression / regulation of morphogenesis of a branching structure / regulation of stem cell differentiation / signal transduction / sympathetic nervous system development / ureteric bud formationComponentsextracellular region
- General Function
- Receptor binding
- Specific Function
- Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake.
- Pfam Domain Function
- TGF_beta (PF00019)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0021849|Glial cell line-derived neurotrophic factor (GDNF) ATGAAGTTATGGGATGTCGTGGCTGTCTGCCTGGTGCTGCTCCACACCGCGTCCGCCTTC CCGCTGCCCGCCGGTAAGAGGCCTCCCGAGGCGCCCGCCGAAGACCGCTCCCTCGGCCGC CGCCGCGCGCCCTTCGCGCTGAGCAGTGACTCAAATATGCCAGAGGATTATCCTGATCAG TTCGATGATGTCATGGATTTTATTCAAGCCACCATTAAAAGACTGAAAAGGTCACCAGAT AAACAAATGGCAGTGCTTCCTAGAAGAGAGCGGAATCGGCAGGCTGCAGCTGCCAACCCA GAGAATTCCAGAGGAAAAGGTCGGAGAGGCCAGAGGGGCAAAAACCGGGGTTGTGTCTTA ACTGCAATACATTTAAATGTCACTGACTTGGGTCTGGGCTATGAAACCAAGGAGGAACTG ATTTTTAGGTACTGCAGCGGCTCTTGCGATGCAGCTGAGACAACGTACGACAAAATATTG AAAAACTTATCCAGAAATAGAAGGCTGGTGAGTGACAAAGTAGGGCAGGCATGTTGCAGA CCCATCGCCTTTGATGATGACCTGTCGTTTTTAGATGATAACCTGGTTTACCATATTCTA AGAAAGCATTCCGCTAAAAGGTGTGGATGTATCTGA
- Chromosome Location
- 5
- Locus
- 5p13.1-p12
- External Identifiers
Resource Link UniProtKB ID P39905 UniProtKB Entry Name GDNF_HUMAN GenBank Gene ID L19063 GenAtlas ID GDNF HGNC ID HGNC:4232 - General References
- Lin LF, Doherty DH, Lile JD, Bektesh S, Collins F: GDNF: a glial cell line-derived neurotrophic factor for midbrain dopaminergic neurons. Science. 1993 May 21;260(5111):1130-2. [Article]
- Schaar DG, Sieber BA, Sherwood AC, Dean D, Mendoza G, Ramakrishnan L, Dreyfus CF, Black IB: Multiple astrocyte transcripts encode nigral trophic factors in rat and human. Exp Neurol. 1994 Dec;130(2):387-93. [Article]
- Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Baecker PA, Lee WH, Verity AN, Eglen RM, Johnson RM: Characterization of a promoter for the human glial cell line-derived neurotrophic factor gene. Brain Res Mol Brain Res. 1999 Jun 8;69(2):209-22. [Article]
- Grimm L, Holinski-Feder E, Teodoridis J, Scheffer B, Schindelhauer D, Meitinger T, Ueffing M: Analysis of the human GDNF gene reveals an inducible promoter, three exons, a triplet repeat within the 3'-UTR and alternative splice products. Hum Mol Genet. 1998 Nov;7(12):1873-86. [Article]
- Haniu M, Hui J, Young Y, Le J, Katta V, Lee R, Shimamoto G, Rohde MF: Glial cell line-derived neurotrophic factor: selective reduction of the intermolecular disulfide linkage and characterization of its disulfide structure. Biochemistry. 1996 Dec 24;35(51):16799-805. [Article]
- Airavaara M, Pletnikova O, Doyle ME, Zhang YE, Troncoso JC, Liu QR: Identification of novel GDNF isoforms and cis-antisense GDNFOS gene and their regulation in human middle temporal gyrus of Alzheimer disease. J Biol Chem. 2011 Dec 30;286(52):45093-102. doi: 10.1074/jbc.M111.310250. Epub 2011 Nov 11. [Article]
- Hofstra RM, Osinga J, Buys CH: Mutations in Hirschsprung disease: when does a mutation contribute to the phenotype. Eur J Hum Genet. 1997 Jul-Aug;5(4):180-5. [Article]
- Parkash V, Goldman A: Comparison of GFL-GFRalpha complexes: further evidence relating GFL bend angle to RET signalling. Acta Crystallogr Sect F Struct Biol Cryst Commun. 2009 Jun 1;65(Pt 6):551-8. doi: 10.1107/S1744309109017722. Epub 2009 May 23. [Article]
- Ivanchuk SM, Myers SM, Eng C, Mulligan LM: De novo mutation of GDNF, ligand for the RET/GDNFR-alpha receptor complex, in Hirschsprung disease. Hum Mol Genet. 1996 Dec;5(12):2023-6. [Article]
- Angrist M, Bolk S, Halushka M, Lapchak PA, Chakravarti A: Germline mutations in glial cell line-derived neurotrophic factor (GDNF) and RET in a Hirschsprung disease patient. Nat Genet. 1996 Nov;14(3):341-4. [Article]
- Salomon R, Attie T, Pelet A, Bidaud C, Eng C, Amiel J, Sarnacki S, Goulet O, Ricour C, Nihoul-Fekete C, Munnich A, Lyonnet S: Germline mutations of the RET ligand GDNF are not sufficient to cause Hirschsprung disease. Nat Genet. 1996 Nov;14(3):345-7. [Article]
- Amiel J, Salomon R, Attie T, Pelet A, Trang H, Mokhtari M, Gaultier C, Munnich A, Lyonnet S: Mutations of the RET-GDNF signaling pathway in Ondine's curse. Am J Hum Genet. 1998 Mar;62(3):715-7. [Article]
- Martucciello G, Ceccherini I, Lerone M, Jasonni V: Pathogenesis of Hirschsprung's disease. J Pediatr Surg. 2000 Jul;35(7):1017-25. [Article]