Lantibiotic mersacidin
Details
- Name
- Lantibiotic mersacidin
- Synonyms
- Lantibiotic mersacidin precursor
- Gene Name
- mrsA
- Organism
- Bacillus sp. (strain HIL-Y85/54728)
- Amino acid sequence
>lcl|BSEQ0016857|Lantibiotic mersacidin MSQEAIIRSWKDPFSRENSTQNPAGNPFSELKEAQMDKLVGAGDMEAACTFTLPGGGGVC TLTSECIC
- Number of residues
- 68
- Molecular Weight
- 7228.065
- Theoretical pI
- 4.17
- GO Classification
- Processescytolysis / defense response to bacterium
- General Function
- Not Available
- Specific Function
- Kills a number of Gram-positive bacteria. Acts at the level of cell wall biosynthesis by interfering with bacterial peptidoglycan biosynthesis. Specifically inhibits the conversion of the lipid II intermediate into polymeric nascent glycan strands by transglycosylation. May interact with the peptidoglycan precursor rather than with the enzyme.
- Pfam Domain Function
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0005231|207 bp ATGAGTCAAGAAGCTATCATTCGTTCATGGAAAGATCCTTTTTCCCGTGAAAATTCTACA CAAAATCCAGCTGGTAACCCATTCAGTGAGCTGAAAGAAGCACAAATGGATAAGTTAGTA GGTGCGGGAGACATGGAAGCAGCATGTACTTTTACATTGCCTGGTGGCGGCGGTGTTTGT ACTCTAACTTCTGAATGTATTTGTTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P43683 UniProtKB Entry Name MRSA_BACSY GenBank Gene ID Z47559 - General References
- Bierbaum G, Brotz H, Koller KP, Sahl HG: Cloning, sequencing and production of the lantibiotic mersacidin. FEMS Microbiol Lett. 1995 Mar 15;127(1-2):121-6. [Article]
- Altena K, Guder A, Cramer C, Bierbaum G: Biosynthesis of the lantibiotic mersacidin: organization of a type B lantibiotic gene cluster. Appl Environ Microbiol. 2000 Jun;66(6):2565-71. [Article]
- Brotz H, Bierbaum G, Reynolds PE, Sahl HG: The lantibiotic mersacidin inhibits peptidoglycan biosynthesis at the level of transglycosylation. Eur J Biochem. 1997 May 15;246(1):193-9. [Article]
- Prasch T, Naumann T, Markert RL, Sattler M, Schubert W, Schaal S, Bauch M, Kogler H, Griesinger C: Constitution and solution conformation of the antibiotic mersacidin determined by NMR and molecular dynamics. Eur J Biochem. 1997 Mar 1;244(2):501-12. [Article]
- Schneider TR, Karcher J, Pohl E, Lubini P, Sheldrick GM: Ab initio structure determination of the lantibiotic mersacidin. Acta Crystallogr D Biol Crystallogr. 2000 Jun;56(Pt 6):705-13. [Article]