Eotaxin

Details

Name
Eotaxin
Synonyms
  • C-C motif chemokine 11
  • Eosinophil chemotactic protein
  • SCYA11
  • Small-inducible cytokine A11
Gene Name
CCL11
Organism
Humans
Amino acid sequence
>lcl|BSEQ0012371|Eotaxin
MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQK
AVIFKTKLAKDICADPKKKWVQDSMKYLDQKSPTPKP
Number of residues
97
Molecular Weight
10731.7
Theoretical pI
10.65
GO Classification
Functions
CCR chemokine receptor binding / chemokine activity
Processes
actin filament organization / branching involved in mammary gland duct morphogenesis / cell adhesion / cellular calcium ion homeostasis / cellular response to interferon-gamma / cellular response to interleukin-1 / cellular response to tumor necrosis factor / chemokine-mediated signaling pathway / chemotaxis / chronic inflammatory response / cytoskeleton organization / eosinophil chemotaxis / ERK1 and ERK2 cascade / G-protein coupled receptor signaling pathway / inflammatory response / lymphocyte chemotaxis / mammary duct terminal end bud growth / mast cell chemotaxis / monocyte chemotaxis / neutrophil chemotaxis / positive regulation of actin filament polymerization / positive regulation of angiogenesis / positive regulation of cell migration / positive regulation of endothelial cell proliferation / positive regulation of ERK1 and ERK2 cascade / positive regulation of GTPase activity / protein phosphorylation / regulation of cell shape / response to interleukin-13 / response to interleukin-4 / response to radiation / response to virus / signal transduction
Components
cell / extracellular region / extracellular space / intracellular
General Function
Chemokine activity
Specific Function
In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Binds to CCR3.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0012372|Eotaxin (CCL11)
ATGAAGGTCTCCGCAGCACTTCTGTGGCTGCTGCTCATAGCAGCTGCCTTCAGCCCCCAG
GGGCTCGCTGGGCCAGCTTCTGTCCCAACCACCTGCTGCTTTAACCTGGCCAATAGGAAG
ATACCCCTTCAGCGACTAGAGAGCTACAGGAGAATCACCAGTGGCAAATGTCCCCAGAAA
GCTGTGATCTTCAAGACCAAACTGGCCAAGGATATCTGTGCCGACCCCAAGAAGAAGTGG
GTGCAGGATTCCATGAAGTATCTGGACCAAAAATCTCCAACTCCAAAGCCATAA
Chromosome Location
17
Locus
17q21.1-q21.2
External Identifiers
ResourceLink
UniProtKB IDP51671
UniProtKB Entry NameCCL11_HUMAN
GenBank Gene IDU46573
GenAtlas IDCCL11
HGNC IDHGNC:10610
General References
  1. Garcia-Zepeda EA, Rothenberg ME, Ownbey RT, Celestin J, Leder P, Luster AD: Human eotaxin is a specific chemoattractant for eosinophil cells and provides a new mechanism to explain tissue eosinophilia. Nat Med. 1996 Apr;2(4):449-56. [Article]
  2. Ponath PD, Qin S, Ringler DJ, Clark-Lewis I, Wang J, Kassam N, Smith H, Shi X, Gonzalo JA, Newman W, Gutierrez-Ramos JC, Mackay CR: Cloning of the human eosinophil chemoattractant, eotaxin. Expression, receptor binding, and functional properties suggest a mechanism for the selective recruitment of eosinophils. J Clin Invest. 1996 Feb 1;97(3):604-12. [Article]
  3. Kitaura M, Nakajima T, Imai T, Harada S, Combadiere C, Tiffany HL, Murphy PM, Yoshie O: Molecular cloning of human eotaxin, an eosinophil-selective CC chemokine, and identification of a specific eosinophil eotaxin receptor, CC chemokine receptor 3. J Biol Chem. 1996 Mar 29;271(13):7725-30. [Article]
  4. Bartels J, Schluter C, Richter E, Noso N, Kulke R, Christophers E, Schroder JM: Human dermal fibroblasts express eotaxin: molecular cloning, mRNA expression, and identification of eotaxin sequence variants. Biochem Biophys Res Commun. 1996 Aug 23;225(3):1045-51. [Article]
  5. Garcia-Zepeda EA, Rothenberg ME, Weremowicz S, Sarafi MN, Morton CC, Luster AD: Genomic organization, complete sequence, and chromosomal location of the gene for human eotaxin (SCYA11), an eosinophil-specific CC chemokine. Genomics. 1997 May 1;41(3):471-6. [Article]
  6. Hein H, Schluter C, Kulke R, Christophers E, Schroder JM, Bartels J: Genomic organization, sequence, and transcriptional regulation of the human eotaxin gene. Biochem Biophys Res Commun. 1997 Aug 28;237(3):537-42. [Article]
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  8. Noso N, Bartels J, Mallet AI, Mochizuki M, Christophers E, Schroder JM: Delayed production of biologically active O-glycosylated forms of human eotaxin by tumor-necrosis-factor-alpha-stimulated dermal fibroblasts. Eur J Biochem. 1998 Apr 1;253(1):114-22. [Article]
  9. Crump MP, Rajarathnam K, Kim KS, Clark-Lewis I, Sykes BD: Solution structure of eotaxin, a chemokine that selectively recruits eosinophils in allergic inflammation. J Biol Chem. 1998 Aug 28;273(35):22471-9. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB05429BertilimumabinvestigationalunknownDetails