Eotaxin
Details
- Name
- Eotaxin
- Synonyms
- C-C motif chemokine 11
- Eosinophil chemotactic protein
- SCYA11
- Small-inducible cytokine A11
- Gene Name
- CCL11
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0012371|Eotaxin MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQK AVIFKTKLAKDICADPKKKWVQDSMKYLDQKSPTPKP
- Number of residues
- 97
- Molecular Weight
- 10731.7
- Theoretical pI
- 10.65
- GO Classification
- FunctionsCCR chemokine receptor binding / chemokine activityProcessesactin filament organization / branching involved in mammary gland duct morphogenesis / cell adhesion / cellular calcium ion homeostasis / cellular response to interferon-gamma / cellular response to interleukin-1 / cellular response to tumor necrosis factor / chemokine-mediated signaling pathway / chemotaxis / chronic inflammatory response / cytoskeleton organization / eosinophil chemotaxis / ERK1 and ERK2 cascade / G-protein coupled receptor signaling pathway / inflammatory response / lymphocyte chemotaxis / mammary duct terminal end bud growth / mast cell chemotaxis / monocyte chemotaxis / neutrophil chemotaxis / positive regulation of actin filament polymerization / positive regulation of angiogenesis / positive regulation of cell migration / positive regulation of endothelial cell proliferation / positive regulation of ERK1 and ERK2 cascade / positive regulation of GTPase activity / protein phosphorylation / regulation of cell shape / response to interleukin-13 / response to interleukin-4 / response to radiation / response to virus / signal transductionComponentscell / extracellular region / extracellular space / intracellular
- General Function
- Chemokine activity
- Specific Function
- In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Binds to CCR3.
- Pfam Domain Function
- IL8 (PF00048)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0012372|Eotaxin (CCL11) ATGAAGGTCTCCGCAGCACTTCTGTGGCTGCTGCTCATAGCAGCTGCCTTCAGCCCCCAG GGGCTCGCTGGGCCAGCTTCTGTCCCAACCACCTGCTGCTTTAACCTGGCCAATAGGAAG ATACCCCTTCAGCGACTAGAGAGCTACAGGAGAATCACCAGTGGCAAATGTCCCCAGAAA GCTGTGATCTTCAAGACCAAACTGGCCAAGGATATCTGTGCCGACCCCAAGAAGAAGTGG GTGCAGGATTCCATGAAGTATCTGGACCAAAAATCTCCAACTCCAAAGCCATAA
- Chromosome Location
- 17
- Locus
- 17q21.1-q21.2
- External Identifiers
Resource Link UniProtKB ID P51671 UniProtKB Entry Name CCL11_HUMAN GenBank Gene ID U46573 GenAtlas ID CCL11 HGNC ID HGNC:10610 - General References
- Garcia-Zepeda EA, Rothenberg ME, Ownbey RT, Celestin J, Leder P, Luster AD: Human eotaxin is a specific chemoattractant for eosinophil cells and provides a new mechanism to explain tissue eosinophilia. Nat Med. 1996 Apr;2(4):449-56. [Article]
- Ponath PD, Qin S, Ringler DJ, Clark-Lewis I, Wang J, Kassam N, Smith H, Shi X, Gonzalo JA, Newman W, Gutierrez-Ramos JC, Mackay CR: Cloning of the human eosinophil chemoattractant, eotaxin. Expression, receptor binding, and functional properties suggest a mechanism for the selective recruitment of eosinophils. J Clin Invest. 1996 Feb 1;97(3):604-12. [Article]
- Kitaura M, Nakajima T, Imai T, Harada S, Combadiere C, Tiffany HL, Murphy PM, Yoshie O: Molecular cloning of human eotaxin, an eosinophil-selective CC chemokine, and identification of a specific eosinophil eotaxin receptor, CC chemokine receptor 3. J Biol Chem. 1996 Mar 29;271(13):7725-30. [Article]
- Bartels J, Schluter C, Richter E, Noso N, Kulke R, Christophers E, Schroder JM: Human dermal fibroblasts express eotaxin: molecular cloning, mRNA expression, and identification of eotaxin sequence variants. Biochem Biophys Res Commun. 1996 Aug 23;225(3):1045-51. [Article]
- Garcia-Zepeda EA, Rothenberg ME, Weremowicz S, Sarafi MN, Morton CC, Luster AD: Genomic organization, complete sequence, and chromosomal location of the gene for human eotaxin (SCYA11), an eosinophil-specific CC chemokine. Genomics. 1997 May 1;41(3):471-6. [Article]
- Hein H, Schluter C, Kulke R, Christophers E, Schroder JM, Bartels J: Genomic organization, sequence, and transcriptional regulation of the human eotaxin gene. Biochem Biophys Res Commun. 1997 Aug 28;237(3):537-42. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Noso N, Bartels J, Mallet AI, Mochizuki M, Christophers E, Schroder JM: Delayed production of biologically active O-glycosylated forms of human eotaxin by tumor-necrosis-factor-alpha-stimulated dermal fibroblasts. Eur J Biochem. 1998 Apr 1;253(1):114-22. [Article]
- Crump MP, Rajarathnam K, Kim KS, Clark-Lewis I, Sykes BD: Solution structure of eotaxin, a chemokine that selectively recruits eosinophils in allergic inflammation. J Biol Chem. 1998 Aug 28;273(35):22471-9. [Article]