Beclin-1
Details
- Name
- Beclin-1
- Synonyms
- Coiled-coil myosin-like BCL2-interacting protein
- GT197
- Protein GT197
- Gene Name
- BECN1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0049743|Beclin-1 MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEE ETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTG DLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQL QMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQ LELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFF WDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN SEEQWTKALKFMLTNLKWGLAWVSSQFYNK
- Number of residues
- 450
- Molecular Weight
- 51895.945
- Theoretical pI
- Not Available
- GO Classification
- Functionsphosphatidylinositol 3-kinase binding / ubiquitin protein ligase bindingProcessesaging / apoptotic process / autophagosome assembly / autophagy / beta-amyloid metabolic process / cellular defense response / cellular response to aluminum ion / cellular response to amino acid starvation / cellular response to copper ion / cellular response to epidermal growth factor stimulus / cellular response to glucose starvation / cellular response to hydrogen peroxide / cellular response to nitrogen starvation / cytokinesis / defense response to virus / engulfment of apoptotic cell / late endosome to vacuole transport / lysosome organization / macroautophagy / macromitophagy / mitophagy / mitotic metaphase plate congression / negative regulation of apoptotic process / negative regulation of cell death / negative regulation of cell proliferation / negative regulation of lysosome organization / negative regulation of reactive oxygen species metabolic process / neuron development / nucleophagy / positive regulation of attachment of mitotic spindle microtubules to kinetochore / positive regulation of autophagosome assembly / positive regulation of phosphatidylinositol 3-kinase signaling / protein deubiquitination / receptor catabolic process / regulation of catalytic activity / regulation of cytokinesis / response to drug / response to hypoxia / response to iron(II) ion / response to lead ion / response to mitochondrial depolarisation / response to vitamin EComponentsautophagosome / cytosol / dendrite / endoplasmic reticulum / endoplasmic reticulum membrane / endosome / endosome membrane / extrinsic component of membrane / mitochondrial membrane / nucleus / phagocytic vesicle / phosphatidylinositol 3-kinase complex, class III / phosphatidylinositol 3-kinase complex, class III, type I / phosphatidylinositol 3-kinase complex, class III, type II / pre-autophagosomal structure / protein complex / trans-Golgi network
- General Function
- Plays a central role in autophagy (PubMed:23184933). Acts as core subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate; different complex forms are believed to play a role in multiple membrane trafficking pathways: PI3KC3-C1 is involved in initiation of autophagosomes and PI3KC3-C2 in maturation of autophagosomes and endocytosis. Involved in regulation of degradative endocytic trafficking and required for the abcission step in cytokinesis, probably in the context of PI3KC3-C2 (PubMed:20643123, PubMed:20208530). Essential for the formation of PI3KC3-C2 but not PI3KC3-C1 PI3K complex forms. Involved in endocytosis (PubMed:25275521). Protects against infection by a neurovirulent strain of Sindbis virus (PubMed:9765397). May play a role in antiviral host defense.
- Specific Function
- Phosphatidylinositol 3-kinase binding
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0049744|Beclin-1 (BECN1) ATGGAAGGGTCTAAGACGTCCAACAACAGCACCATGCAGGTGAGCTTCGTGTGCCAGCGC TGCAGCCAGCCCCTGAAACTGGACACGAGTTTCAAGATCCTGGACCGTGTCACCATCCAG GAACTCACAGCTCCATTACTTACCACAGCCCAGGCGAAACCAGGAGAGACCCAGGAGGAA GAGACTAACTCAGGAGAGGAGCCATTTATTGAAACTCCTCGCCAGGATGGTGTCTCTCGC AGATTCATCCCCCCAGCCAGGATGATGTCCACAGAAAGTGCCAACAGCTTCACTCTGATT GGGGAGGCATCTGATGGCGGCACCATGGAGAACCTCAGCCGAAGACTGAAGGTCACTGGG GACCTTTTTGACATCATGTCGGGCCAGACAGATGTGGATCACCCACTCTGTGAGGAATGC ACAGATACTCTTTTAGACCAGCTGGACACTCAGCTCAACGTCACTGAAAATGAGTGTCAG AACTACAAACGCTGTTTGGAGATCTTAGAGCAAATGAATGAGGATGACAGTGAACAGTTA CAGATGGAGCTAAAGGAGCTGGCACTAGAGGAGGAGAGGCTGATCCAGGAGCTGGAAGAC GTGGAAAAGAACCGCAAGATAGTGGCAGAAAATCTCGAGAAGGTCCAGGCTGAGGCTGAG AGACTGGATCAGGAGGAAGCTCAGTATCAGAGAGAATACAGTGAATTTAAACGACAGCAG CTGGAGCTGGATGATGAGCTGAAGAGTGTTGAAAACCAGATGCGTTATGCCCAGACGCAG CTGGATAAGCTGAAGAAAACCAACGTCTTTAATGCAACCTTCCACATCTGGCACAGTGGA CAGTTTGGCACAATCAATAACTTCAGGCTGGGTCGCCTGCCCAGTGTTCCCGTGGAATGG AATGAGATTAATGCTGCTTGGGGCCAGACTGTGTTGCTGCTCCATGCTCTGGCCAATAAG ATGGGTCTGAAATTTCAGAGATACCGACTTGTTCCTTACGGAAACCATTCATATCTGGAG TCTCTGACAGACAAATCTAAGGAGCTGCCGTTATACTGTTCTGGGGGGTTGCGGTTTTTC TGGGACAACAAGTTTGACCATGCAATGGTGGCTTTCCTGGACTGTGTGCAGCAGTTCAAA GAAGAGGTTGAGAAAGGCGAGACACGTTTTTGTCTTCCCTACAGGATGGATGTGGAGAAA GGCAAGATTGAAGACACAGGAGGCAGTGGCGGCTCCTATTCCATCAAAACCCAGTTTAAC TCTGAGGAGCAGTGGACAAAAGCTCTCAAGTTCATGCTGACGAATCTTAAGTGGGGTCTT GCTTGGGTGTCCTCACAATTTTATAACAAATGA
- Chromosome Location
- 17
- Locus
- 17q21.31
- External Identifiers
Resource Link UniProtKB ID Q14457 UniProtKB Entry Name BECN1_HUMAN HGNC ID HGNC:1034 - General References
- Liang XH, Kleeman LK, Jiang HH, Gordon G, Goldman JE, Berry G, Herman B, Levine B: Protection against fatal Sindbis virus encephalitis by beclin, a novel Bcl-2-interacting protein. J Virol. 1998 Nov;72(11):8586-96. [Article]
- Aita VM, Liang XH, Murty VV, Pincus DL, Yu W, Cayanis E, Kalachikov S, Gilliam TC, Levine B: Cloning and genomic organization of beclin 1, a candidate tumor suppressor gene on chromosome 17q21. Genomics. 1999 Jul 1;59(1):59-65. [Article]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Rommens JM, Durocher F, McArthur J, Tonin P, LeBlanc JF, Allen T, Samson C, Ferri L, Narod S, Morgan K, et al.: Generation of a transcription map at the HSD17B locus centromeric to BRCA1 at 17q21. Genomics. 1995 Aug 10;28(3):530-42. [Article]
- Pattingre S, Tassa A, Qu X, Garuti R, Liang XH, Mizushima N, Packer M, Schneider MD, Levine B: Bcl-2 antiapoptotic proteins inhibit Beclin 1-dependent autophagy. Cell. 2005 Sep 23;122(6):927-39. [Article]
- Maiuri MC, Le Toumelin G, Criollo A, Rain JC, Gautier F, Juin P, Tasdemir E, Pierron G, Troulinaki K, Tavernarakis N, Hickman JA, Geneste O, Kroemer G: Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1. EMBO J. 2007 May 16;26(10):2527-39. Epub 2007 Apr 19. [Article]
- Itakura E, Kishi C, Inoue K, Mizushima N: Beclin 1 forms two distinct phosphatidylinositol 3-kinase complexes with mammalian Atg14 and UVRAG. Mol Biol Cell. 2008 Dec;19(12):5360-72. doi: 10.1091/mbc.E08-01-0080. Epub 2008 Oct 8. [Article]
- Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [Article]
- Sauermann M, Sahin O, Sultmann H, Hahne F, Blaszkiewicz S, Majety M, Zatloukal K, Fuzesi L, Poustka A, Wiemann S, Arlt D: Reduced expression of vacuole membrane protein 1 affects the invasion capacity of tumor cells. Oncogene. 2008 Feb 21;27(9):1320-6. Epub 2007 Aug 27. [Article]
- Sun Q, Fan W, Chen K, Ding X, Chen S, Zhong Q: Identification of Barkor as a mammalian autophagy-specific factor for Beclin 1 and class III phosphatidylinositol 3-kinase. Proc Natl Acad Sci U S A. 2008 Dec 9;105(49):19211-6. doi: 10.1073/pnas.0810452105. Epub 2008 Dec 2. [Article]
- Zalckvar E, Berissi H, Mizrachy L, Idelchuk Y, Koren I, Eisenstein M, Sabanay H, Pinkas-Kramarski R, Kimchi A: DAP-kinase-mediated phosphorylation on the BH3 domain of beclin 1 promotes dissociation of beclin 1 from Bcl-XL and induction of autophagy. EMBO Rep. 2009 Mar;10(3):285-92. doi: 10.1038/embor.2008.246. Epub 2009 Jan 30. [Article]
- Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [Article]
- Thoresen SB, Pedersen NM, Liestol K, Stenmark H: A phosphatidylinositol 3-kinase class III sub-complex containing VPS15, VPS34, Beclin 1, UVRAG and BIF-1 regulates cytokinesis and degradative endocytic traffic. Exp Cell Res. 2010 Dec 10;316(20):3368-78. doi: 10.1016/j.yexcr.2010.07.008. Epub 2010 Jul 17. [Article]
- Matsunaga K, Saitoh T, Tabata K, Omori H, Satoh T, Kurotori N, Maejima I, Shirahama-Noda K, Ichimura T, Isobe T, Akira S, Noda T, Yoshimori T: Two Beclin 1-binding proteins, Atg14L and Rubicon, reciprocally regulate autophagy at different stages. Nat Cell Biol. 2009 Apr;11(4):385-96. doi: 10.1038/ncb1846. Epub 2009 Mar 8. [Article]
- Luo S, Rubinsztein DC: Apoptosis blocks Beclin 1-dependent autophagosome synthesis: an effect rescued by Bcl-xL. Cell Death Differ. 2010 Feb;17(2):268-77. doi: 10.1038/cdd.2009.121. Epub 2009 Aug 28. [Article]
- Wirawan E, Vande Walle L, Kersse K, Cornelis S, Claerhout S, Vanoverberghe I, Roelandt R, De Rycke R, Verspurten J, Declercq W, Agostinis P, Vanden Berghe T, Lippens S, Vandenabeele P: Caspase-mediated cleavage of Beclin-1 inactivates Beclin-1-induced autophagy and enhances apoptosis by promoting the release of proapoptotic factors from mitochondria. Cell Death Dis. 2010;1:e18. doi: 10.1038/cddis.2009.16. [Article]
- Tang D, Kang R, Livesey KM, Cheh CW, Farkas A, Loughran P, Hoppe G, Bianchi ME, Tracey KJ, Zeh HJ 3rd, Lotze MT: Endogenous HMGB1 regulates autophagy. J Cell Biol. 2010 Sep 6;190(5):881-92. doi: 10.1083/jcb.200911078. [Article]
- Sagona AP, Nezis IP, Pedersen NM, Liestol K, Poulton J, Rusten TE, Skotheim RI, Raiborg C, Stenmark H: PtdIns(3)P controls cytokinesis through KIF13A-mediated recruitment of FYVE-CENT to the midbody. Nat Cell Biol. 2010 Apr;12(4):362-71. doi: 10.1038/ncb2036. Epub 2010 Mar 7. [Article]
- Li H, Wang P, Sun Q, Ding WX, Yin XM, Sobol RW, Stolz DB, Yu J, Zhang L: Following cytochrome c release, autophagy is inhibited during chemotherapy-induced apoptosis by caspase 8-mediated cleavage of Beclin 1. Cancer Res. 2011 May 15;71(10):3625-34. doi: 10.1158/0008-5472.CAN-10-4475. Epub 2011 Mar 28. [Article]
- Liu J, Xia H, Kim M, Xu L, Li Y, Zhang L, Cai Y, Norberg HV, Zhang T, Furuya T, Jin M, Zhu Z, Wang H, Yu J, Li Y, Hao Y, Choi A, Ke H, Ma D, Yuan J: Beclin1 controls the levels of p53 by regulating the deubiquitination activity of USP10 and USP13. Cell. 2011 Sep 30;147(1):223-34. doi: 10.1016/j.cell.2011.08.037. [Article]
- Platta HW, Abrahamsen H, Thoresen SB, Stenmark H: Nedd4-dependent lysine-11-linked polyubiquitination of the tumour suppressor Beclin 1. Biochem J. 2012 Jan 1;441(1):399-406. doi: 10.1042/BJ20111424. [Article]
- Ma C, Wang N, Detre C, Wang G, O'Keeffe M, Terhorst C: Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex. J Biol Chem. 2012 May 25;287(22):18359-65. doi: 10.1074/jbc.M112.367060. Epub 2012 Apr 9. [Article]
- Chaumorcel M, Lussignol M, Mouna L, Cavignac Y, Fahie K, Cotte-Laffitte J, Geballe A, Brune W, Beau I, Codogno P, Esclatine A: The human cytomegalovirus protein TRS1 inhibits autophagy via its interaction with Beclin 1. J Virol. 2012 Mar;86(5):2571-84. doi: 10.1128/JVI.05746-11. Epub 2011 Dec 28. [Article]
- Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. [Article]
- Margariti A, Li H, Chen T, Martin D, Vizcay-Barrena G, Alam S, Karamariti E, Xiao Q, Zampetaki A, Zhang Z, Wang W, Jiang Z, Gao C, Ma B, Chen YG, Cockerill G, Hu Y, Xu Q, Zeng L: XBP1 mRNA splicing triggers an autophagic response in endothelial cells through BECLIN-1 transcriptional activation. J Biol Chem. 2013 Jan 11;288(2):859-72. doi: 10.1074/jbc.M112.412783. Epub 2012 Nov 26. [Article]
- Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S: Toward a comprehensive characterization of a human cancer cell phosphoproteome. J Proteome Res. 2013 Jan 4;12(1):260-71. doi: 10.1021/pr300630k. Epub 2012 Dec 18. [Article]
- Fogel AI, Dlouhy BJ, Wang C, Ryu SW, Neutzner A, Hasson SA, Sideris DP, Abeliovich H, Youle RJ: Role of membrane association and Atg14-dependent phosphorylation in beclin-1-mediated autophagy. Mol Cell Biol. 2013 Sep;33(18):3675-88. doi: 10.1128/MCB.00079-13. Epub 2013 Jul 22. [Article]
- Seto S, Sugaya K, Tsujimura K, Nagata T, Horii T, Koide Y: Rab39a interacts with phosphatidylinositol 3-kinase and negatively regulates autophagy induced by lipopolysaccharide stimulation in macrophages. PLoS One. 2013 Dec 13;8(12):e83324. doi: 10.1371/journal.pone.0083324. eCollection 2013. [Article]
- Mandell MA, Jain A, Arko-Mensah J, Chauhan S, Kimura T, Dinkins C, Silvestri G, Munch J, Kirchhoff F, Simonsen A, Wei Y, Levine B, Johansen T, Deretic V: TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition. Dev Cell. 2014 Aug 25;30(4):394-409. doi: 10.1016/j.devcel.2014.06.013. Epub 2014 Aug 7. [Article]
- McKnight NC, Zhong Y, Wold MS, Gong S, Phillips GR, Dou Z, Zhao Y, Heintz N, Zong WX, Yue Z: Beclin 1 is required for neuron viability and regulates endosome pathways via the UVRAG-VPS34 complex. PLoS Genet. 2014 Oct 2;10(10):e1004626. doi: 10.1371/journal.pgen.1004626. eCollection 2014 Oct. [Article]
- Baskaran S, Carlson LA, Stjepanovic G, Young LN, Kim do J, Grob P, Stanley RE, Nogales E, Hurley JH: Architecture and dynamics of the autophagic phosphatidylinositol 3-kinase complex. Elife. 2014 Dec 9;3. doi: 10.7554/eLife.05115. [Article]
- Siddiqui MA, Mukherjee S, Manivannan P, Malathi K: RNase L Cleavage Products Promote Switch from Autophagy to Apoptosis by Caspase-Mediated Cleavage of Beclin-1. Int J Mol Sci. 2015 Jul 31;16(8):17611-36. doi: 10.3390/ijms160817611. [Article]
- Kimura T, Jain A, Choi SW, Mandell MA, Schroder K, Johansen T, Deretic V: TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity. J Cell Biol. 2015 Sep 14;210(6):973-89. [Article]
- Oberstein A, Jeffrey PD, Shi Y: Crystal structure of the Bcl-XL-Beclin 1 peptide complex: Beclin 1 is a novel BH3-only protein. J Biol Chem. 2007 Apr 27;282(17):13123-32. Epub 2007 Mar 2. [Article]
- Feng W, Huang S, Wu H, Zhang M: Molecular basis of Bcl-xL's target recognition versatility revealed by the structure of Bcl-xL in complex with the BH3 domain of Beclin-1. J Mol Biol. 2007 Sep 7;372(1):223-35. Epub 2007 Jun 30. [Article]
- Sinha S, Colbert CL, Becker N, Wei Y, Levine B: Molecular basis of the regulation of Beclin 1-dependent autophagy by the gamma-herpesvirus 68 Bcl-2 homolog M11. Autophagy. 2008 Nov;4(8):989-97. Epub 2008 Nov 18. [Article]
- Su M, Mei Y, Sanishvili R, Levine B, Colbert CL, Sinha S: Targeting gamma-herpesvirus 68 Bcl-2-mediated down-regulation of autophagy. J Biol Chem. 2014 Mar 21;289(12):8029-40. doi: 10.1074/jbc.M113.515361. Epub 2014 Jan 17. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00783 Estradiol approved, investigational, vet_approved unknown binder Details DB13952 Estradiol acetate approved, investigational, vet_approved unknown Details DB13953 Estradiol benzoate approved, investigational, vet_approved unknown Details DB13954 Estradiol cypionate approved, investigational, vet_approved unknown Details DB13955 Estradiol dienanthate approved, investigational, vet_approved unknown Details DB13956 Estradiol valerate approved, investigational, vet_approved unknown Details