Hydrolase
Details
- Name
- Hydrolase
- Synonyms
- Not Available
- Gene Name
- Not Available
- Organism
- Alicyclobacillus acidocaldarius
- Amino acid sequence
>lcl|BSEQ0022041|Hydrolase MPLDPVIQQVLDQLNRMPAPDYKHLSAQQFRSQQSLFPPVKKEPVAEVREFDMDLPGRTL KVRMYRPEGVEPPYPALVYYHGGGWVVGDLETHDPVCRVLAKDGRAVVFSVDYRLAPEHK FPAAVEDAYDALQWIAERAADFHLDPARIAVGGDSAGGNLAAVTSILAKERGGPALAFQL LIYPSTGYDPAHPPASIEENAEGYLLTGGMMLWFRDQYLNSLEELTHPWFSPVLYPDLSG LPPAYIATAQYDPLRDVGKLYAEALNKAGVKVEIENFEDLIHGFAQFYSLSPGATKALVR IAEKLRDALA
- Number of residues
- 310
- Molecular Weight
- 34302.735
- Theoretical pI
- 4.85
- GO Classification
- Functionshydrolase activity
- General Function
- Hydrolase activity
- Specific Function
- Not Available
- Pfam Domain Function
- Abhydrolase_3 (PF07859)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q7SIG1 UniProtKB Entry Name Q7SIG1_ALIAC - General References
- De Simone G, Galdiero S, Manco G, Lang D, Rossi M, Pedone C: A snapshot of a transition state analogue of a novel thermophilic esterase belonging to the subfamily of mammalian hormone-sensitive lipase. J Mol Biol. 2000 Nov 10;303(5):761-71. [Article]
- De Simone G, Mandrich L, Menchise V, Giordano V, Febbraio F, Rossi M, Pedone C, Manco G: A substrate-induced switch in the reaction mechanism of a thermophilic esterase: kinetic evidences and structural basis. J Biol Chem. 2004 Feb 20;279(8):6815-23. Epub 2003 Nov 15. [Article]
- De Simone G, Menchise V, Alterio V, Mandrich L, Rossi M, Manco G, Pedone C: The crystal structure of an EST2 mutant unveils structural insights on the H group of the carboxylesterase/lipase family. J Mol Biol. 2004 Oct 8;343(1):137-46. [Article]
- Mandrich L, Menchise V, Alterio V, De Simone G, Pedone C, Rossi M, Manco G: Functional and structural features of the oxyanion hole in a thermophilic esterase from Alicyclobacillus acidocaldarius. Proteins. 2008 Jun;71(4):1721-31. [Article]