Drugbank Logo

Showing drug card for Phenylephrine (DB00388)

Legend: drug field target field enzyme field

for drugs
Version 2.5
Creation Date 2005-06-13 13:24:05
Update Date 2009-06-23 18:07:07
Primary Accession Number DB00388
Secondary Accession Number
  • APRD00365
Name Phenylephrine
Drug Type
  • Approved
  • Small Molecule
Description An alpha-adrenergic agonist used as a mydriatic, nasal decongestant, and cardiotonic agent. [PubChem]
Synonyms
  1. Fenilefrina [INN-Spanish]
  2. L-Phenylephedrine
  3. L-Phenylephrine
  4. M-Methylaminoethanolphenol
  5. M-Oxedrine
  6. Metaoxedrin
  7. Metaoxedrine
  8. Metaoxedrinum
  9. Metasynephrine
  10. Phenylephrinum [INN-Latin]
Brand Names
  1. AK-Dilate
  2. AK-Nefrin
  3. Adrianol
  4. Alcon Efrin
  5. Alconefrin Nasal Drops 12
  6. Alconefrin Nasal Drops 25
  7. Alconefrin Nasal Drops 50
  8. Alconefrin Nasal Spray 25
  9. Biomydrin
  10. Dilatair
  11. Dimetane
  12. Dionephrine
  13. Doktors
  14. Duration
  15. I-Phrine
  16. Isophrim
  17. Isophrin
  18. Isopto Frin
  19. M-Sympathol
  20. M-Sympatol
  21. M-Synephrine
  22. Mesaton
  23. Mesatone
  24. Mesatonum
  25. Metasympatol
  26. Metsatonum
  27. Mezaton
  28. Minims Phenylephrine
  29. Mydfrin
  30. Neo-Synephrine
  31. Neo-Synephrine Nasal Drops
  32. Neo-Synephrine Nasal Jelly
  33. Neo-Synephrine Nasal Spray
  34. Neofrin
  35. Neophryn
  36. Neosynephrine
  37. Nostril
  38. Nostril Spray Pump
  39. Nostril Spray Pump Mild
  40. Ocu-Phrin Sterile Eye Drops
  41. Ocugestrin
  42. Phenoptic
  43. Prefrin
  44. Prefrin Liquifilm
  45. Pyracort D
  46. Relief Eye Drops for Red Eyes
  47. Rhinall
  48. Spersaphrine
  49. Vicks Sinex
  50. Visadron
Brand Mixtures
  1. AK Vernacon Oph Soln (Pheniramine Maleate + Phenylephrine Hydrochloride)
  2. Biohisdex DM Decongestant (Dextromethorphan Hydrobromide + Diphenylpyraline Hydrochloride + Phenylephrine Hydrochloride)
  3. Biohisdine DM Decongestant (Dextromethorphan Hydrobromide + Diphenylpyraline Hydrochloride + Phenylephrine Hydrochloride)
  4. Chemhisdex DM Decongestant (Dextromethorphan Hydrobromide + Diphenylpyraline Hydrochloride + Phenylephrine Hydrochloride)
  5. Chemhisdine DM Decongestant (Dextromethorphan Hydrobromide + Diphenylpyraline Hydrochloride + Phenylephrine Hydrochloride)
  6. Citron Chaud Cumberland Pws (Acetaminophen + Pheniramine Maleate + Phenylephrine Hydrochloride + Vitamin C)
  7. Citron Chaud DM Cumberland Pws (Dextromethorphan Hydrobromide + Pheniramine Maleate + Phenylephrine Hydrochloride + Vitamin C)
  8. Codalin (Codeine Phosphate + Diphenylpyraline Hydrochloride + Phenylephrine Hydrochloride)
  9. Cold & Allergy (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
  10. Cold & Allergy Relief - Liq (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
  11. Cough, Cold & Allergy Relief (Brompheniramine Maleate + Dextromethorphan Hydrobromide + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
  12. DayQuil (Acetaminophen + Dextromethorphan + Phenylephrine)
  13. Decongestant Antihistaminic Syrup (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
  14. Dimetane Expectorant Liq (Brompheniramine Maleate + Guaifenesin + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
  15. Dimetane Expectorant-C Syr (Brompheniramine Maleate + Codeine Phosphate + Guaifenesin + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
  16. Dimetane Expectorant-DC Syr (Brompheniramine Maleate + Guaifenesin + Hydrocodone Bitartrate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
  17. Dimetapp (Brompheniramine Maleate + Phenylephrine Hydrochloride)
  18. Dimetapp Cold & Sinus (Acetaminophen + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
  19. Dimetapp DM Elixir (Brompheniramine Maleate + Dextromethorphan Hydrobromide + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
  20. Dimetapp DM Tab (Brompheniramine Maleate + Dextromethorphan Hydrobromide + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
  21. Dimetapp Elixir (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
  22. Dimetapp Extentabs (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
  23. Dimetapp Extra Strength (Brompheniramine Maleate + Phenylephrine Hydrochloride)
  24. Dimetapp Oral Infant Cold Drops (Brompheniramine Maleate + Phenylephrine Hydrochloride)
  25. Dimetapp Oral Infant Drops (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
  26. Dimetapp Tab (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
  27. Dimetapp-C Syr (Brompheniramine Maleate + Codeine Phosphate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
  28. Hemorrhoidal Ointment (Mineral Oil + Petrolatum + Phenylephrine Hydrochloride + Shark Liver Oil)
  29. Hot Lemon Relief DM Adult (Dextromethorphan Hydrobromide + Pheniramine Maleate + Phenylephrine Hydrochloride)
  30. Hot Lemon Relief Pws (Acetaminophen + Pheniramine Maleate + Phenylephrine Hydrochloride + Vitamin C)
  31. Hot Lemon Relief for Cold Symptoms Ext Str (Acetaminophen + Pheniramine Maleate + Phenylephrine Hydrochloride + Vitamin C)
  32. Hot Lemon Relief for Cold Symptoms Pws (Acetaminophen + Pheniramine Maleate + Phenylephrine Hydrochloride + Vitamin C)
  33. Hot Lemon for Colds Powder (Acetaminophen + Pheniramine Maleate + Phenylephrine Hydrochloride + Vitamin C)
  34. Lemon Relief for Adults (Acetaminophen + Pheniramine Maleate + Phenylephrine Hydrochloride)
  35. Lemon Time (Acetaminophen + Phenylephrine Hydrochloride + Pyrilamine Maleate + Vitamin C)
  36. Neo Citran Extra Strength (Acetaminophen + Pheniramine Maleate + Phenylephrine Hydrochloride)
  37. Neo Citran Nutrasweet (Acetaminophen + Pheniramine Maleate + Phenylephrine Hydrochloride)
  38. Neo Citran Powder (Acetaminophen + Pheniramine Maleate + Phenylephrine Hydrochloride + Vitamin C)
  39. Neo Citran a Powder (Pheniramine Maleate + Phenylephrine Hydrochloride + Vitamin C)
  40. Neo Synephrine Nasal Spray (Phenylephrine Hydrochloride + Thenyldiamine Hcl.)
  41. Neo-Synephrine Nasal Spray (Phenylephrine Hydrochloride + Thenyldiamine Hcl.)
  42. Nezger Tab (Acetylsalicylic Acid + Diphenylpyraline Hydrochloride + Guaifenesin + Phenylephrine Hydrochloride)
  43. Novahistex C (Codeine Phosphate + Phenylephrine Hydrochloride)
  44. Novahistex Dh Expectorant (Guaifenesin + Hydrocodone Bitartrate + Phenylephrine Hydrochloride)
  45. Occu-Cal Drops (Boric Acid + Phenylephrine Hydrochloride + Sodium Borate)
  46. Occu-Cal Lotion (Boric Acid + Phenylephrine Hydrochloride + Sodium Borate)
  47. Pharmetapp Elixir (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
  48. Phenergan VC Expectorant Syr (Phenylephrine Hydrochloride + Potassium Guaiacol Sulphonate + Promethazine Hydrochloride)
  49. Phenergan VC Expectorant W Codeine Liq (Codeine Phosphate + Phenylephrine Hydrochloride + Potassium Guaiacol Sulphonate + Promethazine Hydrochloride)
  50. Soframycin Nasal Spray (Framycetin Sulfate + Gramicidin + Phenylephrine Hydrochloride)
  51. Tantapp Elixir (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
  52. Vasosulf Oph Soln (Phenylephrine Hydrochloride + Sulfacetamide Sodium)
Chemical IUPAC Name 3-[(1R)-1-hydroxy-2-methylaminoethyl]phenol
Chemical Formula C9H13NO2
Chemical Structure Structure
CAS Registry Number 59-42-7
InChI Identifier InChI=1/C9H13NO2/c1-10-6-9(12)7-3-2-4-8(11)5-7/h2-5,9-12H,6H2,1H3/t9-/m0/s1
InChI Key SONNWYBIRXJNDC-VIFPVBQEBB
KEGG Drug Not Available
KEGG Compound C07441 Link Image
PubChem Compound 6041 Link Image
PubChem Substance 9645 Link Image
ChEBI ID 8093 Link Image
PharmGKB ID PA450935 Link Image
HET ID Not Available
GenBank ID Not Available
Drug ID Number [DIN] 02238400 Link Image
RxList Link http://www.rxlist.com/cgi/generic3/phenyleph.htm Link Image
PDRhealth Link Not Available
Wikipedia Link http://en.wikipedia.org/wiki/Phenylephrine Link Image
FDA Label Not Available
Material Safety Data Sheet (MSDS)
Synthesis Reference Synthesis from m-benzyloxybenzaldehyde: Bergmann, Sulzbacher, J. Org. Chem. 16, 84 (1951)
Average Molecular Weight 167.2050
Monoisotopic Molecular Weight 167.0946
State Solid
Melting Point 140-145 oC
Experimental Water Solubility Freely soluble in water Source: PhysProp
Predicted Water Solubility 2.20e+01 mg/mL Calculated using ALOGPS
Experimental LogP/Hydrophobicity 0.5 Source: PhysProp
Predicted LogP -0.68 Calculated using ALOGPS
Experimental LogS Not Available
Predicted LogS -0.88 Calculated using ALOGPS
Experimental Caco2 Permeability Not Available
pKa/Isoelectric Point Not Available
Mass Spectrum Not Available
MOL File Show Link Image | Download Link Image
SDF File Show Link Image | Download Link Image
PDB File Show Link Image | Download Link Image
2D Structure
3D Structure
Experimental PDB ID Not Available
Isomeric SMILES CNC[C@H](O)C1=CC(O)=CC=C1
Canonical SMILES CNCC(O)C1=CC(O)=CC=C1
Drug Category
  • Adrenergic alpha-Agonists
  • Cardiotonic Agents
  • Mydriatics
  • Nasal Decongestants
  • Sympathomimetics
  • Vasoconstrictor Agents
ATC Codes
AHFS Codes
  • 12:12.04
  • 52:24.00
  • 52:32.00
  • 84:92.00
Indication For the treatment of ophthalmic disorders (hyperaemia of conjunctiva, posterior synechiae, acute atopic), nasal congestion, hemorrhoids, hypotension, shock, hypotension during spinal anesthesia, paroxysmal supraventricular tachycardia. It is also used as an aid in the diagnosis of heart murmurs and for prolongation of spinal anesthesia
Pharmacology Phenylephrine is a powerful vasoconstrictor. It is used as a mydriatic, nasal decongestant, and cardiotonic agent. Phenylephrine is a postsynaptic alpha-receptor stimulant with little effect on the beta receptors of the heart. Parenteral administration of Phenylephrine causes a rise in systolic and diastolic pressures, cardiac output is slightly decreased and peripheral resistance is considerably increased, most vascular beds are constricted; renal, splanchnic, cutaneous, and limb blood flows are reduced but coronary blood flow is increased. Pulmonary vessels are constricted, and pulmonary arterial pressure is raised. This alpha receptor sympathetic agonist is also used locally because its vasoconstrictor and mydriatic action.
Mechanism of Action Phenylephrine produces its ophthalmic and systemic actions by acting on alpha 1 adrenergic receptors in the pupillary dilator muscle and the vascular smooth musle, resulting in contraction of the dilator muscle and contraction of the smooth muscle in the arterioles of the conjunctiva and peripheral vasoconstriction. Phenylephrine decreases nasal congestion by acting on alpha 1 adrenergic receptors in the arterioles of the nasal mucosa to produce constriction.
Absorption Reduced bioavailability (compared to pseudoephedrine) following oral administration due to significant first-pass metabolism.
Toxicity Not Available
Protein Binding 95% binding-plasma proteins
Biotransformation Oral phenylephrine is extensively metabolised by monoamine oxidase, an enzyme which is present in the stomach and liver.
Half Life 2.1 to 3.4 hours
Dosage Forms
Form Route
Liquid Intramuscular
Liquid Intravenous
Liquid Ophthalmic
Ointment Topical
Solution Intravenous
Solution / drops Ophthalmic
Strip Oral
Tablet Oral
Patient Information Not Available
Contraindications Show Link Image
Interactions Show Link Image
Drug Interactions
Drug Interaction
Alseroxylon Increased arterial pressure
Amitriptyline The tricyclic increases the sympathomimetic effect
Amoxapine The tricyclic increases the sympathomimetic effect
Clomipramine The tricyclic increases the sympathomimetic effect
Deserpidine Increased arterial pressure
Desipramine The tricyclic increases the sympathomimetic effect
Doxepin The tricyclic increases the sympathomimetic effect
Ergonovine Possible marked increase of arterial pressure
Guanethidine The agent decreases the effect of guanethidine
Imipramine The tricyclic increases the sympathomimetic effect
Isocarboxazid Increased arterial pressure
Linezolid Possible increase of arterial pressure
Methyldopa Increased arterial pressure
Methylergonovine Possible marked increase of arterial pressure
Midodrine Increased arterial pressure
Moclobemide Moclobemide increases the sympathomimetic effect
Nortriptyline The tricyclic increases the sympathomimetic effect
Oxytocin Possible marked increase of arterial pressure
Pargyline Increased arterial pressure
Phenelzine Increased arterial pressure
Protriptyline The tricyclic increases the sympathomimetic effect
Rasagiline Increased arterial pressure
Reserpine Increased arterial pressure
Tranylcypromine Increased arterial pressure
Trimipramine The tricyclic increases the sympathomimetic effect
Food Interactions
  • Take without regard to meals.
Pathways Not Available
General References
  1. Drugs.com Link Image
  2. Wikipedia Link Image
  3. RxList Link Image
Organisms Affected
  • Humans and other mammals
Phase 1 Metabolizing Enzymes
  1. Monoamine oxidase type A (MAO-A)
Targets
  1. Alpha-1A adrenergic receptor
  2. Alpha-1B adrenergic receptor
Phase 1 Metabolizing Enzyme 1 [top]
Enzyme 1 Name Monoamine oxidase type A (MAO-A)
Enzyme 1 Gene Name MAOA
Enzyme 1 SwissProt ID P21397 Link Image
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 Protein Sequence >sp|P21397|AOFA_HUMAN Amine oxidase [flavin-containing] 
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Drug Target 1 [top]
Target 1 ID 556
Target 1 Name Alpha-1A adrenergic receptor
Target 1 Synonyms
  1. Alpha 1A- adrenoreceptor
  2. Alpha 1A-adrenoceptor
  3. Alpha adrenergic receptor 1c
  4. Alpha-1C adrenergic receptor
Target 1 Gene Name ADRA1A
Target 1 Protein Sequence >Alpha-1A adrenergic receptor 
MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL
HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
Target 1 Number of Residues 473
Target 1 Molecular Weight 51487
Target 1 Theoretical pI 9.23
Target 1 GO Classification
Function
signal transducer activity
receptor activity
transmembrane receptor activity
G-protein coupled receptor activity
rhodopsin-like receptor activity
amine receptor activity
adrenoceptor activity
alpha-adrenergic receptor activity
alpha1-adrenergic receptor activity
Process
cellular process
cell communication
signal transduction
cell surface receptor linked signal transduction
G-protein coupled receptor protein signaling pathway
Component
cell
membrane
intrinsic to membrane
integral to membrane
Target 1 General Function Involved in alpha1-adrenergic receptor activity
Target 1 Specific Function This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol- calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins
Target 1 Pathways Not Available
Target 1 Reactions Not Available
Target 1 Pfam Domain Function
Target 1 Signals
  • None
Target 1 Transmembrane Regions
  • 28-51
  • 65-88
  • 100-122
  • 144-167
  • 182-205
  • 274-297
  • 306-329
Target 1 Essentiality Non-Essential
Target 1 GenBank ID Protein 433201 Link Image
Target 1 UniProtKB/Swiss-Prot ID P35348 Link Image
Target 1 UniProtKB/Swiss-Prot Entry Name ADA1A_HUMAN Link Image
Target 1 PDB ID Not Available
Target 1 Cellular Location
  • Membrane
  • multi-pass membrane protein
Target 1 Gene Sequence >1401 bp 
ATGGTGTTTCTCTCGGGAAATGCTTCCGACAGCTCCAACTGCACCCAACCGCCGGCACCG
GTGAACATTTCCAAGGCCATTCTGCTCGGGGTGATCTTGGGGGGCCTCATTCTTTTCGGG
GTGCTGGGTAACATCCTAGTGATCCTCTCCGTAGCCTGTCACCGACACCTGCACTCAGTC
ACGCACTACTACATCGTCAACCTGGCGGTGGCCGACCTCCTGCTCACCTCCACGGTGCTG
CCCTTCTCCGCCATCTTCGAGGTCCTAGGCTACTGGGCCTTCGGCAGGGTCTTCTGCAAC
ATCTGGGCGGCAGTGGATGTGCTGTGCTGCACCGCGTCCATCATGGGCCTCTGCATCATC
TCCATCGACCGCTACATCGGCGTGAGCTACCCGCTGCGCTACCCAACCATCGTCACCCAG
AGGAGGGGTCTCATGGCTCTGCTCTGCGTCTGGGCACTCTCCCTGGTCATATCCATTGGA
CCCCTGTTCGGCTGGAGGCAGCCGGCCCCCGAGGACGAGACCATCTGCCAGATCAACGAG
GAGCCGGGCTACGTGCTCTTCTCAGCGCTGGGCTCCTTCTACCTGCCTCTGGCCATCATC
CTGGTCATGTACTGCCGCGTCTACGTGGTGGCCAAGAGGGAGAGCCGGGGCCTCAAGTCT
GGCCTCAAGACCGACAAGTCGGACTCGGAGCAAGTGACGCTCCGCATCCATCGGAAAAAC
GCCCCGGCAGGAGGCAGCGGGATGGCCAGCGCCAAGACCAAGACGCACTTCTCAGTGAGG
CTCCTCAAGTTCTCCCGGGAGAAGAAAGCGGCCAAAACGCTGGGCATCGTGGTCGGCTGC
TTCGTCCTCTGCTGGCTGCCTTTTTTCTTAGTCATGCCCATTGGGTCTTTCTTCCCTGAT
TTCAAGCCCTCTGAAACAGTTTTTAAAATAGTATTTTGGCTCGGATATCTAAACAGCTGC
ATCAACCCCATCATATACCCATGCTCCAGCCAAGAGTTCAAAAAGGCCTTTCAGAATGTC
TTGAGAATCCAGTGTCTCCGCAGAAAGCAGTCTTCCAAACATGCCCTGGGCTACACCCTG
CACCCGCCCAGCCAGGCCGTGGAAGGGCAACACAAGGACATGGTGCGCATCCCCGTGGGA
TCAAGAGAGACCTTCTACAGGATCTCCAAGACGGATGGCGTTTGTGAATGGAAATTTTTC
TCTTCCATGCCCCGTGGATCTGCCAGGATTACAGTGTCCAAAGACCAATCCTCCTGTACC
ACAGCCCGGGTGAGAAGTAAAAGCTTTTTGGAGGTCTGCTGCTGTGTAGGGCCCTCAACC
CCCAGCCTTGACAAGAACCATCAAGTTCCAACCATTAAGGTCCACACCATCTCCCTCAGT
GAGAACGGGGAGGAAGTCTAG
Target 1 GenBank Gene ID
Target 1 GeneCard ID ADRA1A Link Image
Target 1 GenAtlas ID ADRA1A Link Image
Target 1 HGNC ID HGNC:277 Link Image
Target 1 Chromosome Location 8
Target 1 Locus 8p21-p11.2
Target 1 SNPs SNPJam Report Link Image
Target 1 General References
  1. Hirasawa A, Shibata K, Horie K, Takei Y, Obika K, Tanaka T, Muramoto N, Takagaki K, Yano J, Tsujimoto G: Cloning, functional expression and tissue distribution of human alpha 1c-adrenoceptor splice variants. FEBS Lett. 1995 Apr 24;363(3):256-60. [PubMed Link Image]
  2. Schwinn DA, Johnston GI, Page SO, Mosley MJ, Wilson KH, Worman NP, Campbell S, Fidock MD, Furness LM, Parry-Smith DJ, et al.: Cloning and pharmacological characterization of human alpha-1 adrenergic receptors: sequence corrections and direct comparison with other species homologues. J Pharmacol Exp Ther. 1995 Jan;272(1):134-42. [PubMed Link Image]
  3. Weinberg DH, Trivedi P, Tan CP, Mitra S, Perkins-Barrow A, Borkowski D, Strader CD, Bayne M: Cloning, expression and characterization of human alpha adrenergic receptors alpha 1a, alpha 1b and alpha 1c. Biochem Biophys Res Commun. 1994 Jun 30;201(3):1296-304. [PubMed Link Image]
  4. Forray C, Bard JA, Wetzel JM, Chiu G, Shapiro E, Tang R, Lepor H, Hartig PR, Weinshank RL, Branchek TA, et al.: The alpha 1-adrenergic receptor that mediates smooth muscle contraction in human prostate has the pharmacological properties of the cloned human alpha 1c subtype. Mol Pharmacol. 1994 Apr;45(4):703-8. [PubMed Link Image]
  5. Hirasawa A, Horie K, Tanaka T, Takagaki K, Murai M, Yano J, Tsujimoto G: Cloning, functional expression and tissue distribution of human cDNA for the alpha 1C-adrenergic receptor. Biochem Biophys Res Commun. 1993 Sep 15;195(2):902-9. [PubMed Link Image]
  6. Tseng-Crank J, Kost T, Goetz A, Hazum S, Roberson KM, Haizlip J, Godinot N, Robertson CN, Saussy D: The alpha 1C-adrenoceptor in human prostate: cloning, functional expression, and localization to specific prostatic cell types. Br J Pharmacol. 1995 Aug;115(8):1475-85. [PubMed Link Image]
  7. Chang DJ, Chang TK, Yamanishi SS, Salazar FH, Kosaka AH, Khare R, Bhakta S, Jasper JR, Shieh IS, Lesnick JD, Ford AP, Daniels DV, Eglen RM, Clarke DE, Bach C, Chan HW: Molecular cloning, genomic characterization and expression of novel human alpha1A-adrenoceptor isoforms. FEBS Lett. 1998 Jan 30;422(2):279-83. [PubMed Link Image]
Target 1 Drug References
  1. Martinez-Salas SG, Campos-Peralta JM, Pares-Hipolito J, Gallardo-Ortiz IA, Ibarra M, Villalobos-Molina R: Alpha1A-adrenoceptors predominate in the control of blood pressure in mouse mesenteric vascular bed. Auton Autacoid Pharmacol. 2007 Jul;27(3):137-42. [PubMed Link Image]
  2. Tomiyama Y, Kobayashi K, Tadachi M, Kobayashi S, Inada Y, Kobayashi M, Yamazaki Y: Expressions and mechanical functions of alpha(1)-adrenoceptor subtypes in hamster ureter. Eur J Pharmacol. 2007 Nov 14;573(1-3):201-5. Epub 2007 Jul 6. [PubMed Link Image]
Drug Target 2 [top]
Target 2 ID 632
Target 2 Name Alpha-1B adrenergic receptor
Target 2 Synonyms
  1. Alpha 1B- adrenoreceptor
  2. Alpha 1B-adrenoceptor
Target 2 Gene Name ADRA1B
Target 2 Protein Sequence >Alpha-1B adrenergic receptor 
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV
RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT
LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT
EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
Target 2 Number of Residues 528
Target 2 Molecular Weight 56837
Target 2 Theoretical pI 9.79
Target 2 GO Classification
Function
signal transducer activity
receptor activity
transmembrane receptor activity
G-protein coupled receptor activity
rhodopsin-like receptor activity
amine receptor activity
adrenoceptor activity
alpha-adrenergic receptor activity
alpha1-adrenergic receptor activity
Process
cellular process
cell communication
signal transduction
cell surface receptor linked signal transduction
G-protein coupled receptor protein signaling pathway
Component
cell
membrane
intrinsic to membrane
integral to membrane
Target 2 General Function Involved in alpha1-adrenergic receptor activity
Target 2 Specific Function This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol- calcium second messenger system
Target 2 Pathways Not Available
Target 2 Reactions Not Available
Target 2 Pfam Domain Function
Target 2 Signals
  • None
Target 2 Transmembrane Regions
  • 46-70
  • 84-105
  • 116-141
  • 162-182
  • 202-224
  • 296-319
  • 327-340
Target 2 Essentiality Non-Essential
Target 2 GenBank ID Protein Not Available
Target 2 UniProtKB/Swiss-Prot ID P35368 Link Image
Target 2 UniProtKB/Swiss-Prot Entry Name ADA1B_HUMAN Link Image
Target 2 PDB ID Not Available
Target 2 Cellular Location
  • Membrane
  • multi-pass membrane protein
Target 2 Gene Sequence Not Available
Target 2 GenBank Gene ID
Target 2 GeneCard ID ADRA1B Link Image
Target 2 GenAtlas ID ADRA1B Link Image
Target 2 HGNC ID HGNC:278 Link Image
Target 2 Chromosome Location 5
Target 2 Locus 5q23-q32
Target 2 SNPs SNPJam Report Link Image
Target 2 General References
  1. Ramarao CS, Denker JM, Perez DM, Gaivin RJ, Riek RP, Graham RM: Genomic organization and expression of the human alpha 1B-adrenergic receptor. J Biol Chem. 1992 Oct 25;267(30):21936-45. [PubMed Link Image]
  2. Schwinn DA, Johnston GI, Page SO, Mosley MJ, Wilson KH, Worman NP, Campbell S, Fidock MD, Furness LM, Parry-Smith DJ, et al.: Cloning and pharmacological characterization of human alpha-1 adrenergic receptors: sequence corrections and direct comparison with other species homologues. J Pharmacol Exp Ther. 1995 Jan;272(1):134-42. [PubMed Link Image]
  3. Forray C, Bard JA, Wetzel JM, Chiu G, Shapiro E, Tang R, Lepor H, Hartig PR, Weinshank RL, Branchek TA, et al.: The alpha 1-adrenergic receptor that mediates smooth muscle contraction in human prostate has the pharmacological properties of the cloned human alpha 1c subtype. Mol Pharmacol. 1994 Apr;45(4):703-8. [PubMed Link Image]
Target 2 Drug References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed Link Image]

This project is supported by Genome Alberta & Genome Canada, a not-for-profit organization that is leading Canada's national genomics strategy with $600 million in funding from the federal government. This project is also supported in part by GenomeQuest, Inc., an enterprise genomic information company serving the life science community.