| Version |
2.5 |
| Creation Date |
2005-06-13 13:24:05 |
| Update Date |
2009-06-23 18:06:11 |
| Primary Accession Number |
DB00446 |
| Secondary Accession Number |
|
| Name |
Chloramphenicol |
| Drug Type |
|
| Description |
An antibiotic first isolated from cultures of Streptomyces venequelae in 1947 but now produced synthetically. It has a relatively simple structure and was the first broad-spectrum antibiotic to be discovered. It acts by interfering with bacterial protein synthesis and is mainly bacteriostatic. (From Martindale, The Extra Pharmacopoeia, 29th ed, p106) |
| Synonyms |
- CAF
- CAM
- CAP
- CPh
- Chloramfenikol
- Chloramphenicole
- Chloroamphenicol
- Cloroamfenicolo
- D-Chloramphenicol
|
| Brand Names |
- Ak-Chlor Ophthalmic Ointment
- Ak-Chlor Ophthalmic Solution
- Ak-chlor
- Alficetyn
- Ambofen
- Amphenicol
- Amphicol
- Amseclor
- Anacetin
- Aquamycetin
- Austracil
- Austracol
- Biocetin
- Biophenicol
- Catilan
- Chemicetin
- Chemicetina
- Chlomin
- Chlomycol
- Chlora-Tabs
- Chloracol Ophthalmic Solution
- Chloramex
- Chloramficin
- Chloramfilin
- Chloramsaar
- Chlorasol
- Chloricol
- Chlornitromycin
- Chloro-25 vetag
- Chlorocaps
- Chlorocid
- Chlorocid S
- Chlorocide
- Chlorocidin C
- Chlorocidin C tetran
- Chlorocol
- Chlorofair
- Chlorofair Ophthalmic Ointment
- Chlorofair Ophthalmic Solution
- Chloroject L
- Chloromax
- Chloromycetin Hydrocortisone
- Chloromycetin Ophthalmic Ointment
- Chloromycetin Palmitate
- Chloromycetin for Ophthalmic Solution
- Chloromycetny
- Chloromyxin
- Chloronitrin
- Chloroptic
- Chloroptic Ophthalmic Solution
- Chloroptic S.O.P.
- Chloroptic-P S.O.P.
- Chlorovules
- Cidocetine
- Ciplamycetin
- Cloramfen
- Cloramficin
- Cloramicol
- Cloramidina
- Clorocyn
- Cloromisan
- Clorosintex
- Comycetin
- Cylphenicol
- Desphen
- Detreomycin
- Detreomycine
- Dextromycetin
- Doctamicina
- Econochlor
- Econochlor Ophthalmic Ointment
- Econochlor Ophthalmic Solution
- Elase-Chloromycetin
- Embacetin
- Emetren
- Enicol
- Enteromycetin
- Erbaplast
- Ertilen
- Farmicetina
- Farmitcetina
- Fenicol
- Fenicol Ophthalmic Ointment
- Globenicol
- Glorous
- Halomycetin
- Hortfenicol
- I-Chlor Ophthalmic Solution
- Intramycetin
- Isicetin
- Ismicetina
- Isophenicol
- Isopto fenicol
- Juvamycetin
- Kamaver
- Kemicetina
- Kemicetine
- Klorita
- Klorocid S
- Leukamycin
- Leukomyan
- Leukomycin
- Levomicetina
- Levomitsetin
- Levomycetin
- Loromisan
- Loromisin
- Mastiphen
- Mediamycetine
- Medichol
- Micloretin
- Micochlorine
- Micoclorina
- Microcetina
- Mychel
- Mychel-Vet
- Mycinol
- Normimycin V
- Novochlorocap
- Novomycetin
- Novophenicol
- Ocu-Chlor Ophthalmic Ointment
- Ocu-Chlor Ophthalmic Solution
- Oftalent
- Oleomycetin
- Opclor
- Opelor
- Ophtho-Chloram Ophthalmic Solution
- Ophthochlor
- Ophthochlor Ophthalmic Solution
- Ophthoclor
- Ophthocort
- Ophtochlor
- Optomycin
- Otachron
- Otophen
- Pantovernil
- Paraxin
- Pentamycetin
- Pentamycetin Ophthalmic Ointment
- Pentamycetin Ophthalmic Solution
- Quemicetina
- Rivomycin
- Romphenil
- Ronphenil
- Septicol
- Sificetina
- Sintomicetina
- Sintomicetine R
- Sno-Phenicol
- Sopamycetin Ophthalmic Ointment
- Sopamycetin Ophthalmic Solution
- Spectro-Chlor Ophthalmic Ointment
- Spectro-Chlor Ophthalmic Solution
- Stanomycetin
- Synthomycetin
- Synthomycetine
- Synthomycine
- Tega-Cetin
- Tevcocin
- Tevcosin
- Tifomycin
- Tifomycine
- Tiromycetin
- Treomicetina
- Tyfomycine
- Unimycetin
- Veticol
- Viceton
|
| Brand Mixtures |
- Actinac Pwr (Allantoin + Butoxyethyl Nicotinate + Chloramphenicol + Hydrocortisone Acetate + Sulfur)
- Actinac Pws (Allantoin + Butoxyethyl Nicotinate + Chloramphenicol + Hydrocortisone Acetate + Sulfur)
- Chlorasone (Chloramphenicol + Prednisolone Acetate)
- Elase Chloromycetin Ont (Chloramphenicol + Deoxyribonuclease Pancreatic + Fibrinolysin)
- Liquichlor (Chloramphenicol + Prednisolone + Squalane + Tetracaine)
- Ophthocort Ont (Chloramphenicol + Hydrocortisone Acetate + Polymyxin B)
- Sopamycetin/Hc Ointment (Chloramphenicol + Hydrocortisone Acetate)
- Sopamycetin/Hc Ont (Chloramphenicol + Hydrocortisone Acetate)
- Sopamycetin/Hc Susp (Chloramphenicol + Hydrocortisone Acetate)
- Zoomycetine Spray (Chloramphenicol + Isopropyl Alcohol + Methyl Violet)
|
| Chemical IUPAC Name |
2,2-dichloro-N-[1,3-dihydroxy-1-(4-nitrophenyl)propan-2-yl]acetamide |
| Chemical Formula |
C11H12Cl2N2O5 |
| Chemical Structure |
 |
| CAS Registry Number |
56-75-7 |
| InChI Identifier |
InChI=1/C11H12Cl2N2O5/c12-10(13)11(18)14-8(5-16)9(17)6-1-3-7(4-2-6)15(19)20/h1-4,8-10,16-17H,5H2,(H,14,18)/f/h14H |
| InChI Key |
WIIZWVCIJKGZOK-YHMJCDSICC |
| KEGG Drug |
D00104  |
| KEGG Compound |
C00918  |
| PubChem Compound |
298  |
| PubChem Substance |
4172  |
| ChEBI ID |
17698  |
| PharmGKB ID |
PA448927  |
| HET ID |
CLM  |
| GenBank ID |
Not Available |
| Drug ID Number [DIN] |
00798398  |
| RxList Link |
http://www.rxlist.com/cgi/generic3/chloramphenicol.htm  |
| PDRhealth Link |
Not Available |
| Wikipedia Link |
http://en.wikipedia.org/wiki/Chloramphenicol  |
| FDA Label |
|
| Material Safety Data Sheet (MSDS) |
|
| Synthesis Reference |
Not Available |
| Average Molecular Weight |
323.1290 |
| Monoisotopic Molecular Weight |
322.0123 |
| State |
Solid |
| Melting Point |
150.5 oC |
| Experimental Water Solubility |
2500 mg/L (at 25 °C)
Source: PhysProp
|
| Predicted Water Solubility |
4.61e-01 mg/mL
Calculated using ALOGPS
|
| Experimental LogP/Hydrophobicity |
0.7
Source: PhysProp
|
| Predicted LogP |
1.15
Calculated using ALOGPS
|
| Experimental LogS |
-2.11 [ADME Research, USCD] |
| Predicted LogS |
-2.85
Calculated using ALOGPS
|
| Experimental Caco2 Permeability |
-4.69 [ADME Research, USCD] |
| pKa/Isoelectric Point |
Not Available |
| Mass Spectrum |
Not Available
|
| MOL File |
Show | Download  |
| SDF File |
Show | Download  |
| PDB File |
Show | Download  |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
3CLA  |
| Experimental PDB File |
Show |
| Experimental PDB Structure |
|
| Isomeric SMILES |
OC[C@H](NC(=O)C(Cl)Cl)[C@@H](O)C1=CC=C(C=C1)[N+]([O-])=O |
| Canonical SMILES |
OCC(NC(=O)C(Cl)Cl)C(O)C1=CC=C(C=C1)[N+]([O-])=O |
| Drug Category |
- Anti-Bacterial Agents
- Protein Synthesis Inhibitors
|
| ATC Codes |
|
| AHFS Codes |
|
| Indication |
Used in treatment of cholera, as it destroys the vibrios and decreases the diarrhea. It is effective against tetracycline-resistant vibrios. It is also used in eye drops or ointment to treat bacterial conjunctivitis. |
| Pharmacology |
Chloramphenicol is a broad-spectrum antibiotic that was derived from the bacterium Streptomyces venezuelae and is now produced synthetically. Chloramphenicol is effective against a wide variety of microorganisms, but due to serious side-effects (e.g., damage to the bone marrow, including aplastic anemia) in humans, it is usually reserved for the treatment of serious and life-threatening infections (e.g., typhoid fever). Chloramphenicol is bacteriostatic but may be bactericidal in high concentrations or when used against highly susceptible organisms. Chloramphenicol stops bacterial growth by binding to the bacterial ribosome (blocking peptidyl transferase) and inhibiting protein synthesis. |
| Mechanism of Action |
Chloramphenicol is lipid-soluble, allowing it to diffuse through the bacterial cell membrane. It then reversibly binds to the 50S subunit of bacterial ribosomes where transfer of amino acids to growing peptide chains is prevented (perhaps by suppression of peptidyl transferase activity), thus inhibiting peptide bond formation and subsequent protein synthesis. |
| Absorption |
Rapidly and completely absorbed from gastrointestinal tract following oral administration (bioavailability 80%). Well absorbed following intramuscular administration (bioavailability 70%). Intraocular and some systemic absorption also occurs after topical application to the eye. |
| Toxicity |
Oral, mouse: LD50 = 1500 mg/kg; Oral, rat: LD50 = 2500 mg/kg. Toxic reactions including fatalities have occurred in the premature and newborn; the signs and symptoms associated with these reactions have been referred to as the gray syndrome. Symptoms include (in order of appearance) abdominal distension with or without emesis, progressive pallid cyanosis, vasomotor collapse frequently accompanied by irregular respiration, and death within a few hours of onset of these symptoms. |
| Protein Binding |
Plasma protein binding is 50-60% in adults and 32% is premature neonates. |
| Biotransformation |
Hepatic, with 90% conjugated to inactive glucuronide. |
| Half Life |
Half-life in adults with normal hepatic and renal function is 1.5 - 3.5 hours. In patients with impaired renal function half-life is 3 - 4 hours. In patients with severely impaired hepatic function half-life is 4.6 - 11.6 hours. Half-life in children 1 month to 16 years old is 3 - 6.5 hours, while half-life in infants 1 to 2 days old is 24 hours or longer and is highly variable, especially in low birth-weight infants. |
| Dosage Forms |
| Form |
Route |
| Liquid |
Ophthalmic |
| Ointment |
Ophthalmic |
| Powder, for solution |
Intramuscular |
| Solution |
Ophthalmic |
| Solution / drops |
Ophthalmic |
|
| Patient Information |
Not Available |
| Contraindications |
Not Available |
| Interactions |
Not Available |
| Drug Interactions |
| Drug |
Interaction |
| Acenocoumarol |
Increases the anticoagulant effect |
| Acetohexamide |
The agent increases the effect of sulfonylurea |
| Anisindione |
Increases the anticoagulant effect |
| Chlorpropamide |
The agent increases the effect of sulfonylurea |
| Cyclosporine |
Increases the effect of cyclosporine |
| Dicumarol |
Increases the anticoagulant effect |
| Ethotoin |
Increases phenytoin, modifies chloramphenicol |
| Fosphenytoin |
Increases phenytoin, modifies chloramphenicol |
| Glibenclamide |
The agent increases the effect of sulfonylurea |
| Gliclazide |
The agent increases the effect of sulfonylurea |
| Glipizide |
The agent increases the effect of sulfonylurea |
| Glisoxepide |
The agent increases the effect of sulfonylurea |
| Glycodiazine |
The agent increases the effect of sulfonylurea |
| Mephenytoin |
Increases phenytoin, modifies chloramphenicol |
| Phenytoin |
Increases phenytoin, modifies chloramphenicol |
| Rifampin |
Rifampin decreases the effect of chloramphenicol |
| Tacrolimus |
Increases tacrolimus levels |
| Tolazamide |
The agent increases the effect of sulfonylurea |
| Tolbutamide |
The agent increases the effect of sulfonylurea |
| Warfarin |
Increases the anticoagulant effect |
|
| Food Interactions |
- Take on an empty stomach.
|
| Pathways |
Not Available
|
| General References |
- Bhutta ZA, Niazi SK, Suria A: Chloramphenicol clearance in typhoid fever: implications for therapy. Indian J Pediatr. 1992 Mar-Apr;59(2):213-9. [PubMed
]
- Nathan N, Borel T, Djibo A, Evans D, Djibo S, Corty JF, Guillerm M, Alberti KP, Pinoges L, Guerin PJ, Legros D: Ceftriaxone as effective as long-acting chloramphenicol in short-course treatment of meningococcal meningitis during epidemics: a randomised non-inferiority study. Lancet. 2005 Jul 23-29;366(9482):308-13. [PubMed
]
- Pecoul B, Varaine F, Keita M, Soga G, Djibo A, Soula G, Abdou A, Etienne J, Rey M: Long-acting chloramphenicol versus intravenous ampicillin for treatment of bacterial meningitis. Lancet. 1991 Oct 5;338(8771):862-6. [PubMed
]
- Wali SS, Macfarlane JT, Weir WR, Cleland PG, Ball PA, Hassan-King M, Whittle HC, Greenwood BM: Single injection treatment of meningococcal meningitis. 2. Long-acting chloramphenicol. Trans R Soc Trop Med Hyg. 1979;73(6):698-702. [PubMed
]
- Puddicombe JB, Wali SS, Greenwood BM: A field trial of a single intramuscular injection of long-acting chloramphenicol in the treatment of meningococcal meningitis. Trans R Soc Trop Med Hyg. 1984;78(3):399-403. [PubMed
]
- Wikipedia

- RxList

|
| Organisms Affected |
- Enteric bacteria and other eubacteria
|
| Targets |
- 50S ribosomal protein L10
- Complement decay-accelerating factor
- Chloramphenicol acetyltransferase
- Chloramphenicol 3-O phosphotransferase
- Chloramphenicol acetyltransferase 3
- Dr hemagglutinin structural subunit
|
|
Drug Target 1
[top]
|
| Target 1 ID |
818 |
| Target 1 Name |
50S ribosomal protein L10 |
| Target 1 Synonyms |
Not Available |
| Target 1 Gene Name |
rplJ |
| Target 1 Protein Sequence |
>50S ribosomal protein L10
ALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLR
RAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPAS
QIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA
|
| Target 1 Number of Residues |
166 |
| Target 1 Molecular Weight |
17581 |
| Target 1 Theoretical pI |
9.51 |
| Target 1 GO Classification |
|
Function
|
structural molecule activity
structural constituent of ribosome |
|
Process
|
metabolism
macromolecule metabolism
macromolecule biosynthesis
protein biosynthesis
physiological process
cellular physiological process
cell organization and biogenesis
organelle organization and biogenesis
ribosome biogenesis and assembly |
|
Component
|
protein complex
ribonucleoprotein complex
ribosome
cell
intracellular |
|
| Target 1 General Function |
Translation, ribosomal structure and biogenesis |
| Target 1 Specific Function |
Protein L10 is also a translational repressor protein. It controls the translation of the rplJL-rpoBC operon by binding to its mRNA |
| Target 1 Pathways |
Not Available
|
| Target 1 Reactions |
Not Available |
| Target 1 Pfam Domain Function |
|
| Target 1 Signals |
|
| Target 1 Transmembrane Regions |
|
| Target 1 Essentiality |
Essential |
| Target 1 GenBank ID Protein |
24054563  |
| Target 1 UniProtKB/Swiss-Prot ID |
P0A7J6  |
| Target 1 UniProtKB/Swiss-Prot Entry Name |
RL10_SHIFL  |
| Target 1 PDB ID |
Not Available |
| Target 1 Cellular Location |
Not Available |
| Target 1 Gene Sequence |
>498 bp
ATGGCTTTAAATCTTCAAGACAAACAAGCGATTGTTGCTGAAGTCAGCGAAGTAGCCAAA
GGCGCGCTGTCTGCAGTAGTTGCGGATTCCCGTGGCGTAACTGTAGATAAAATGACTGAA
CTGCGTAAAGCAGGTCGCGAAGCTGGCGTATACATGCGTGTTGTTCGTAACACCCTGCTG
CGCCGTGCTGTTGAAGGTACTCCGTTCGAGTGCCTGAAAGACGCGTTTGTTGGTCCGACC
CTGATTGCATACTCTATGGAACACCCGGGCGCTGCTGCTCGTCTGTTCAAAGAGTTCGCG
AAAGCGAATGCAAAATTTGAGGTCAAAGCCGCTGCCTTTGAAGGTGAGCTGATCCCGGCG
TCTCAGATCGACCGCCTGGCAACTCTGCCGACCTACGAAGAAGCAATTGCACGCCTGATG
GCAACCATGAAAGAAGCTTCGGCTGGCAAACTGGTTCGTACTCTGGCTGCTGTACGCGAT
GCGAAAGAAGCTGCTTAA
|
| Target 1 GenBank Gene ID |
|
| Target 1 GeneCard ID |
Not Available |
| Target 1 GenAtlas ID |
Not Available |
| Target 1 HGNC ID |
Not Available |
| Target 1 Chromosome Location |
Not Available |
| Target 1 Locus |
Not Available |
| Target 1 SNPs |
SNPJam Report  |
| Target 1 General References |
- Jin Q, Yuan Z, Xu J, Wang Y, Shen Y, Lu W, Wang J, Liu H, Yang J, Yang F, Zhang X, Zhang J, Yang G, Wu H, Qu D, Dong J, Sun L, Xue Y, Zhao A, Gao Y, Zhu J, Kan B, Ding K, Chen S, Cheng H, Yao Z, He B, Chen R, Ma D, Qiang B, Wen Y, Hou Y, Yu J: Genome sequence of Shigella flexneri 2a: insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157. Nucleic Acids Res. 2002 Oct 15;30(20):4432-41. [PubMed
]
- Wei J, Goldberg MB, Burland V, Venkatesan MM, Deng W, Fournier G, Mayhew GF, Plunkett G 3rd, Rose DJ, Darling A, Mau B, Perna NT, Payne SM, Runyen-Janecky LJ, Zhou S, Schwartz DC, Blattner FR: Complete genome sequence and comparative genomics of Shigella flexneri serotype 2a strain 2457T. Infect Immun. 2003 May;71(5):2775-86. [PubMed
]
|
| Target 1 Drug References |
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
|
|
Drug Target 2
[top]
|
| Target 2 ID |
1196 |
| Target 2 Name |
Complement decay-accelerating factor |
| Target 2 Synonyms |
- CD55 antigen
- Complement decay-accelerating factor precursor
|
| Target 2 Gene Name |
CD55 |
| Target 2 Protein Sequence |
>Complement decay-accelerating factor precursor
MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTV
ITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFP
VGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGI
LFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGER
DHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPT
TVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLS
GHTCFTLTGLLGTLVTMGLLT
|
| Target 2 Number of Residues |
387 |
| Target 2 Molecular Weight |
41400 |
| Target 2 Theoretical pI |
7.64 |
| Target 2 GO Classification |
Not Available |
| Target 2 General Function |
Not Available |
| Target 2 Specific Function |
Also acts as the receptor for echovirus 7 and related viruses (echoviruses 13, 21, 29 and 33) |
| Target 2 Pathways |
Not Available
|
| Target 2 Reactions |
Not Available |
| Target 2 Pfam Domain Function |
|
| Target 2 Signals |
|
| Target 2 Transmembrane Regions |
|
| Target 2 Essentiality |
Non-Essential |
| Target 2 GenBank ID Protein |
181468  |
| Target 2 UniProtKB/Swiss-Prot ID |
P08174  |
| Target 2 UniProtKB/Swiss-Prot Entry Name |
DAF_HUMAN  |
| Target 2 PDB ID |
1OK9  |
| Target 2 PDB File |
Show |
| Target 2 3D Structure |
|
| Target 2 Cellular Location |
- GPI- anchor
- Isoform 2:Cell membrane
- lipid-anchor
|
| Target 2 Gene Sequence |
>1146 bp
ATGACCGTCGCGCGGCCGAGCGTGCCCGCGGCGCTGCCCCTCCTCGGGGAGCTGCCCCGG
CTGCTGCTGCTGGTGCTGTTGTGCCTGCCGGCCGTGTGGGGTGACTGTGGCCTTCCCCCA
GATGTACCTAATGCCCAGCCAGCTTTGGAAGGCCGTACAAGTTTTCCCGAGGATACTGTA
ATAACGTACAAATGTGAAGAAAGCTTTGTGAAAATTCCTGGCGAGAAGGACTCAGTGATC
TGCCTTAAGGGCAGTCAATGGTCAGATATTGAAGAGTTCTGCAATCGTAGCTGCGAGGTG
CCAACAAGGCTAAATTCTGCATCCCTCAAACAGCCTTATATCACTCAGAATTATTTTCCA
GTCGGTACTGTTGTGGAATATGAGTGCCGTCCAGGTTACAGAAGAGAACCTTCTCTATCA
CCAAAACTAACTTGCCTTCAGAATTTAAAATGGTCCACAGCAGTCGAATTTTGTAAAAAG
AAATCATGCCCTAATCCGGGAGAAATACGAAATGGTCAGATTGATGTACCAGGTGGCATA
TTATTTGGTGCAACCATCTCCTTCTCATGTAACACAGGGTACAAATTATTTGGCTCGACT
TCTAGTTTTTGTCTTATTTCAGGCAGCTCTGTCCAGTGGAGTGACCCGTTGCCAGAGTGC
AGAGAAATTTATTGTCCAGCACCACCACAAATTGACAATGGAATAATTCAAGGGGAACGT
GACCATTATGGATATAGACAGTCTGTAACGTATGCATGTAATAAAGGATTCACCATGATT
GGAGAGCACTCTATTTATTGTACTGTGAATAATGATGAAGGAGAGTGGAGTGGCCCACCA
CCTGAATGCAGAGGAAAATCTCTAACTTCCAAGGTCCCACCAACAGTTCAGAAACCTACC
ACAGTAAATGTTCCAACTACAGAAGTCTCACCAACTTCTCAGAAAACCACCACAAAAACC
ACCACACCAAATGCTCAAGCAACACGGAGTACACCTGTTTCCAGGACAACCAAGCATTTT
CATGAAACAACCCCAAATAAAGGAAGTGGAACCACTTCAGGTACTACCCGTCTTCTATCT
GGGCACACGTGTTTCACGTTGACAGGTTTGCTTGGGACGCTAGTAACCATGGGCTTGCTG
ACTTAG
|
| Target 2 GenBank Gene ID |
|
| Target 2 GeneCard ID |
CD55  |
| Target 2 GenAtlas ID |
CD55  |
| Target 2 HGNC ID |
HGNC:2665  |
| Target 2 Chromosome Location |
1 |
| Target 2 Locus |
1q32 |
| Target 2 SNPs |
SNPJam Report  |
| Target 2 General References |
- Uhrinova S, Lin F, Ball G, Bromek K, Uhrin D, Medof ME, Barlow PN: Solution structure of a functionally active fragment of decay-accelerating factor. Proc Natl Acad Sci U S A. 2003 Apr 15;100(8):4718-23. Epub 2003 Apr 2. [PubMed
]
- Storry JR, Sausais L, Hue-Roye K, Mudiwa F, Ferrer Z, Blajchman MA, Lublin DM, Ma BW, Miquel JF, Nervi F, Pereira J, Reid ME: GUTI: a new antigen in the Cromer blood group system. Transfusion. 2003 Mar;43(3):340-4. [PubMed
]
- Nakano Y, Sumida K, Kikuta N, Miura NH, Tobe T, Tomita M: Complete determination of disulfide bonds localized within the short consensus repeat units of decay accelerating factor (CD55 antigen). Biochim Biophys Acta. 1992 Jun 12;1116(3):235-40. [PubMed
]
- Ewulonu UK, Ravi L, Medof ME: Characterization of the decay-accelerating factor gene promoter region. Proc Natl Acad Sci U S A. 1991 Jun 1;88(11):4675-9. [PubMed
]
- Nakano Y, Sugita Y, Ishikawa Y, Choi NH, Tobe T, Tomita M: Isolation of two forms of decay-accelerating factor (DAF) from human urine. Biochim Biophys Acta. 1991 Jul 8;1074(2):326-30. [PubMed
]
- Reid ME, Mallinson G, Sim RB, Poole J, Pausch V, Merry AH, Liew YW, Tanner MJ: Biochemical studies on red blood cells from a patient with the Inab phenotype (decay-accelerating factor deficiency). Blood. 1991 Dec 15;78(12):3291-7. [PubMed
]
- Moran P, Raab H, Kohr WJ, Caras IW: Glycophospholipid membrane anchor attachment. Molecular analysis of the cleavage/attachment site. J Biol Chem. 1991 Jan 15;266(2):1250-7. [PubMed
]
- Sugita Y, Negoro T, Matsuda T, Sakamoto T, Tomita M: Improved method for the isolation and preliminary characterization of human DAF (decay-accelerating factor). J Biochem (Tokyo). 1986 Jul;100(1):143-50. [PubMed
]
- Caras IW, Davitz MA, Rhee L, Weddell G, Martin DW Jr, Nussenzweig V: Cloning of decay-accelerating factor suggests novel use of splicing to generate two proteins. Nature. 1987 Feb 5-11;325(6104):545-9. [PubMed
]
- Medof ME, Lublin DM, Holers VM, Ayers DJ, Getty RR, Leykam JF, Atkinson JP, Tykocinski ML: Cloning and characterization of cDNAs encoding the complete sequence of decay-accelerating factor of human complement. Proc Natl Acad Sci U S A. 1987 Apr;84(7):2007-11. [PubMed
]
- 7519480 Lublin DM, Mallinson G, Poole J, Reid ME, Thompson ES, Ferdman BR, Telen MJ, Anstee DJ, Tanner MJ: Molecular basis of reduced or absent expression of decay-accelerating factor in Cromer blood group phenotypes. Blood. 1994 Aug 15;84(4):1276-82.
- 7525274 Ward T, Pipkin PA, Clarkson NA, Stone DM, Minor PD, Almond JW: Decay-accelerating factor CD55 is identified as the receptor for echovirus 7 using CELICS, a rapid immuno-focal cloning method. EMBO J. 1994 Nov 1;13(21):5070-4.
|
| Target 2 Drug References |
- Pettigrew D, Anderson KL, Billington J, Cota E, Simpson P, Urvil P, Rabuzin F, Roversi P, Nowicki B, du Merle L, Le Bouguenec C, Matthews S, Lea SM: High resolution studies of the Afa/Dr adhesin DraE and its interaction with chloramphenicol. J Biol Chem. 2004 Nov 5;279(45):46851-7. Epub 2004 Aug 24. [PubMed
]
- Korotkova N, Chattopadhyay S, Tabata TA, Beskhlebnaya V, Vigdorovich V, Kaiser BK, Strong RK, Dykhuizen DE, Sokurenko EV, Moseley SL: Selection for functional diversity drives accumulation of point mutations in Dr adhesins of Escherichia coli. Mol Microbiol. 2007 Apr;64(1):180-94. [PubMed
]
|
|
Drug Target 3
[top]
|
| Target 3 ID |
2417 |
| Target 3 Name |
Chloramphenicol acetyltransferase |
| Target 3 Synonyms |
- EC 2.3.1.28
- XAT
- Xenobiotic acetyltransferase
|
| Target 3 Gene Name |
cat |
| Target 3 Protein Sequence |
>Chloramphenicol acetyltransferase
MGNYFESPFRGKLLSEQVSNPNIRVGRYSYYSGYYHGHSFDDCARYLMPDRDDVDKLVIG
SFCSIGSGAAFIMAGNQGHRAEWASTFPFHFMHEEPVFAGAVNGYQPAGDTLIGHDVWIG
TEAMFMPGVRVGHGAIIGSRALVTGDVEPYAIVGGNPARTIRKRFSDGDIQNLLEMAWWD
WPLADIEAAMPLLCTGDIPALYRHWKQRQATA
|
| Target 3 Number of Residues |
215 |
| Target 3 Molecular Weight |
23525 |
| Target 3 Theoretical pI |
6.07 |
| Target 3 GO Classification |
Not Available |
| Target 3 General Function |
Involved in acyltransferase activity |
| Target 3 Specific Function |
This enzyme is an effector of chloramphenicol (Cm) resistance in bacteria. Acetylates Cm but not 1-acetoxy-Cm |
| Target 3 Pathways |
Not Available
|
| Target 3 Reactions |
- acetyl-CoA + chloramphenicol = CoA + chloramphenicol 3-acetate
|
| Target 3 Pfam Domain Function |
Not Available |
| Target 3 Signals |
|
| Target 3 Transmembrane Regions |
|
| Target 3 Essentiality |
Essential |
| Target 3 GenBank ID Protein |
4104539  |
| Target 3 UniProtKB/Swiss-Prot ID |
P26841  |
| Target 3 UniProtKB/Swiss-Prot Entry Name |
CAT4_PSEAE  |
| Target 3 PDB ID |
2XAT  |
| Target 3 PDB File |
Show |
| Target 3 3D Structure |
|
| Target 3 Cellular Location |
Not Available |
| Target 3 Gene Sequence |
>639 bp
ATGGGCAACTATTTCGAGAGCCCCTTCAGGGGCAAGCTGCTCTCGGAACAGGTCAGCAAC
CCGAACATACGGGTGGGGCGCTACAGCTACTACTCCGGCTACTATCACGGGCATTCCTTC
GACGACTGCGCCCGCTACCTGATGCCGGACCGCGACGACGTGGACAAGCTGGTCATCGGC
AGTTTCTGCTCGATCGGCAGTGGCGCCGCCTTCATCATGGCCGGCAACCAGGGACACCGC
GCCGAATGGGCGTCGACCTTCCCCTTCCACTTCATGCACGAAGAGCCTGTCTTCGCCGGC
GCCGTGAACGGCTATCAGCCAGCCGGCGACACGCTGATCGGCCATGACGTCTGGATCGGT
ACCGAGGCGATGTTCATGCCCGGCGTACGGGTCGGCCACGGAGCCATCATCGGCAGCCGC
GCGCTGGTGACCGGCGATGTCGAGCCCTATGCCATCGTCGGCGGTAACCCGGCCCGGACC
ATTCGTAAGCGCTTTTCCGATGGCGATATCCAGAACCTGCTGGAAATGGCCTGGTGGGAC
TGGCCACTGGCCGATATCGAGGCAGCCATGCCACTGCTGTGTACTGGGGATATCCCCGCC
TTGTACCGGCACTGGAAACAGCGCCAGGCCACGGCCTGA
|
| Target 3 GenBank Gene ID |
|
| Target 3 GeneCard ID |
Not Available |
| Target 3 GenAtlas ID |
Not Available |
| Target 3 HGNC ID |
Not Available |
| Target 3 Chromosome Location |
Not Available |
| Target 3 Locus |
Not Available |
| Target 3 SNPs |
SNPJam Report  |
| Target 3 General References |
- White PA, Stokes HW, Bunny KL, Hall RM: Characterisation of a chloramphenicol acetyltransferase determinant found in the chromosome of Pseudomonas aeruginosa. FEMS Microbiol Lett. 1999 Jun 1;175(1):27-35. [PubMed
]
- Stover CK, Pham XQ, Erwin AL, Mizoguchi SD, Warrener P, Hickey MJ, Brinkman FS, Hufnagle WO, Kowalik DJ, Lagrou M, Garber RL, Goltry L, Tolentino E, Westbrock-Wadman S, Yuan Y, Brody LL, Coulter SN, Folger KR, Kas A, Larbig K, Lim R, Smith K, Spencer D, Wong GK, Wu Z, Paulsen IT, Reizer J, Saier MH, Hancock RE, Lory S, Olson MV: Complete genome sequence of Pseudomonas aeruginosa PA01, an opportunistic pathogen. Nature. 2000 Aug 31;406(6799):959-64. [PubMed
]
- Hindahl MS, Frank DW, Hamood A, Iglewski BH: Characterization of a gene that regulates toxin A synthesis in Pseudomonas aeruginosa. Nucleic Acids Res. 1988 Jun 24;16(12):5699. [PubMed
]
- Tian Y, Beaman TW, Roderick SL: Purification and crystallization of Pseudomonas aeruginosa chloramphenicol acetyltransferase. Proteins. 1997 Jun;28(2):298-300. [PubMed
]
- Beaman TW, Sugantino M, Roderick SL: Structure of the hexapeptide xenobiotic acetyltransferase from Pseudomonas aeruginosa. Biochemistry. 1998 May 12;37(19):6689-96. [PubMed
]
|
| Target 3 Drug References |
- Navia MM, Capitano L, Ruiz J, Vargas M, Urassa H, Schellemberg D, Gascon J, Vila J: Typing and characterization of mechanisms of resistance of Shigella spp. isolated from feces of children under 5 years of age from Ifakara, Tanzania. J Clin Microbiol. 1999 Oct;37(10):3113-7. [PubMed
]
- Potrykus J, Wegrzyn G: Chloramphenicol-sensitive Escherichia coli strain expressing the chloramphenicol acetyltransferase (cat) gene. Antimicrob Agents Chemother. 2001 Dec;45(12):3610-2. [PubMed
]
- Potrykus J, Baranska S, Wegrzyn G: Inactivation of the acrA gene is partially responsible for chloramphenicol sensitivity of Escherichia coli CM2555 strain expressing the chloramphenicol acetyltransferase gene. Microb Drug Resist. 2002 Fall;8(3):179-85. [PubMed
]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
|
|
Drug Target 4
[top]
|
| Target 4 ID |
2718 |
| Target 4 Name |
Chloramphenicol 3-O phosphotransferase |
| Target 4 Synonyms |
- CPT
- EC 2.7.1.-
|
| Target 4 Gene Name |
Not Available |
| Target 4 Protein Sequence |
>Chloramphenicol 3-O phosphotransferase
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADG
GVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVR
CDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
|
| Target 4 Number of Residues |
180 |
| Target 4 Molecular Weight |
18817 |
| Target 4 Theoretical pI |
4.38 |
| Target 4 GO Classification |
Not Available |
| Target 4 General Function |
Not Available |
| Target 4 Specific Function |
Inactivates chloramphenicol by catalyzing the transfer of the gamma-phosphate of ATP to the antibiotic's C-3' hydroxyl group |
| Target 4 Pathways |
Not Available
|
| Target 4 Reactions |
Not Available |
| Target 4 Pfam Domain Function |
|
| Target 4 Signals |
|
| Target 4 Transmembrane Regions |
|
| Target 4 Essentiality |
Essential |
| Target 4 GenBank ID Protein |
498888  |
| Target 4 UniProtKB/Swiss-Prot ID |
Q56148  |
| Target 4 UniProtKB/Swiss-Prot Entry Name |
CPT_STRVL  |
| Target 4 PDB ID |
1GRR  |
| Target 4 PDB File |
Show |
| Target 4 3D Structure |
|
| Target 4 Cellular Location |
Not Available |
| Target 4 Gene Sequence |
>537 bp
GTGACCACTCGGATGATCATCCTCAACGGCGGTTCCAGCGCGGGGAAGTCCGGCATCGTA
CGGTGCCTCCAGTCCGTCCTTCCCGAGCCCTGGCTGGCCTTCGGCGTCGACTCCCTCATC
GAGGCGATGCCCCTGAAGATGCAGAGCGCCGAAGGCGGCATCGAGTTCGACGCCGACGGC
GGGGTGAGCATCGGGCCCGAGTTCCGCGCCCTTGAGGGCGCCTGGGCCGAGGGCGTCGTC
GCGATGGCCCGCGCGGGCGCCCGGATCATCATCGACGACGTCTTCCTCGGCGGTGCCGCC
GCCCAGGAGCGCTGGCGGAGCTTCGTCGGGGACCTGGACGTGCTCTGGGTCGGCGTCCGG
TGCGACGGCGCCGTCGCCGAGGGCCGGGAGACCGCGCGCGGCGACCGCGTCGCGGGCATG
GCGGCGAAGCAGGCGTACGTCGTGCACGAGGGCGTGGAGTACGACGTGGAGGTCGACACC
ACGCACAAGGAGTCGATCGAGTGCGCCTGGGCGATCGCCGCCCACGTCGTCCCGTAG
|
| Target 4 GenBank Gene ID |
|
| Target 4 GeneCard ID |
Not Available |
| Target 4 GenAtlas ID |
Not Available |
| Target 4 HGNC ID |
Not Available |
| Target 4 Chromosome Location |
Not Available |
| Target 4 Locus |
Not Available |
| Target 4 SNPs |
Not Available |
| Target 4 General References |
- Izard T, Ellis J: The crystal structures of chloramphenicol phosphotransferase reveal a novel inactivation mechanism. EMBO J. 2000 Jun 1;19(11):2690-700. [PubMed
]
- Mosher RH, Camp DJ, Yang K, Brown MP, Shaw WV, Vining LC: Inactivation of chloramphenicol by O-phosphorylation. A novel resistance mechanism in Streptomyces venezuelae ISP5230, a chloramphenicol producer. J Biol Chem. 1995 Nov 10;270(45):27000-6. [PubMed
]
|
| Target 4 Drug References |
- Ellis J, Campopiano DJ, Izard T: Cubic crystals of chloramphenicol phosphotransferase from Streptomyces venezuelae in complex with chloramphenicol. Acta Crystallogr D Biol Crystallogr. 1999 May;55(Pt 5):1086-8. [PubMed
]
- Izard T, Ellis J: The crystal structures of chloramphenicol phosphotransferase reveal a novel inactivation mechanism. EMBO J. 2000 Jun 1;19(11):2690-700. [PubMed
]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
- Mosher RH, Camp DJ, Yang K, Brown MP, Shaw WV, Vining LC: Inactivation of chloramphenicol by O-phosphorylation. A novel resistance mechanism in Streptomyces venezuelae ISP5230, a chloramphenicol producer. J Biol Chem. 1995 Nov 10;270(45):27000-6. [PubMed
]
|
|
Drug Target 5
[top]
|
| Target 5 ID |
2808 |
| Target 5 Name |
Chloramphenicol acetyltransferase 3 |
| Target 5 Synonyms |
- Chloramphenicol acetyltransferase III
- EC 2.3.1.28
- catIII
|
| Target 5 Gene Name |
cat3 |
| Target 5 Protein Sequence |
>Chloramphenicol acetyltransferase 3
MNYTKFDVKNWVRREHFEFYRHRLPCGFSLTSKIDITTLKKSLDDSAYKFYPVMIYLIAQ
AVNQFDELRMAIKDDELIVWDSVDPQFTVFHQETETFSALSCPYSSDIDQFMVNYLSVME
RYKSDTKLFPQGVTPENHLNISALPWVNFDSFNLNVANFTDYFAPIITMAKYQQEGDRLL
LPLSVQVHHAVCDGFHVARFINRLQELCNSKLK
|
| Target 5 Number of Residues |
216 |
| Target 5 Molecular Weight |
24994 |
| Target 5 Theoretical pI |
6.15 |
| Target 5 GO Classification |
|
Function
|
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring groups other than amino-acyl groups
acyltransferase activity
O-acyltransferase activity
O-acetyltransferase activity
chloramphenicol O-acetyltransferase activity |
|
Process
|
| Not Available |
|
Component
|
| Not Available |
|
| Target 5 General Function |
Involved in chloramphenicol O-acetyltransferase activity |
| Target 5 Specific Function |
This enzyme is an effector of chloramphenicol resistance in bacteria |
| Target 5 Pathways |
Not Available
|
| Target 5 Reactions |
- acetyl-CoA + chloramphenicol = CoA + chloramphenicol 3-acetate
|
| Target 5 Pfam Domain Function |
|
| Target 5 Signals |
|
| Target 5 Transmembrane Regions |
|
| Target 5 Essentiality |
Essential |
| Target 5 GenBank ID Protein |
47025  |
| Target 5 UniProtKB/Swiss-Prot ID |
P00484  |
| Target 5 UniProtKB/Swiss-Prot Entry Name |
CAT3_ECOLI  |
| Target 5 PDB ID |
3CLA  |
| Target 5 PDB File |
Show |
| Target 5 3D Structure |
|
| Target 5 Cellular Location |
Not Available |
| Target 5 Gene Sequence |
>642 bp
ATGAACTATACAAAATTTGATGTAAAAAATTGGGTTCGCCGTGAGCATTTTGAGTTTTAT
CGGCATCGTTTACCATGTGGTTTTAGCTTAACAAGCAAAATTGATATCACGACGTTAAAA
AAGTCATTGGATGATTCAGCGTATAAGTTTTATCCGGTAATGATCTATCTGATTGCTCAG
GCCGTGAATCAATTTGATGAGTTGAGAATGGCGATAAAAGATGATGAATTGATCGTATGG
GATTCAGTCGACCCACAATTCACCGTATTCCATCAAGAAACAGAGACATTTTCAGCACTG
AGTTGCCCATACTCATCCGATATTGATCAATTTATGGTGAATTATTTATCGGTAATGGAA
CGTTATAAAAGTGATACCAAGTTATTTCCTCAAGGGGTAACACCAGAAAATCATTTAAAT
ATTTCAGCATTACCTTGGGTTAATTTTGATAGCTTTAATTTAAATGTTGCTAATTTTACC
GATTATTTTGCACCCATTATAACAATGGCAAAATATCAGCAAGAAGGGGATAGACTGTTA
TTGCCGCTCTCAGTACAGGTTCATCATGCAGTTTGTGATGGCTTCCATGTTGCACGCTTT
ATTAATCGGCTACAAGAGTTGTGTAACAGTAAATTAAAATAA
|
| Target 5 GenBank Gene ID |
|
| Target 5 GeneCard ID |
Not Available |
| Target 5 GenAtlas ID |
Not Available |
| Target 5 HGNC ID |
Not Available |
| Target 5 Chromosome Location |
Not Available |
| Target 5 Locus |
Not Available |
| Target 5 SNPs |
SNPJam Report  |
| Target 5 General References |
- Leslie AG: Refined crystal structure of type III chloramphenicol acetyltransferase at 1.75 A resolution. J Mol Biol. 1990 May 5;213(1):167-86. [PubMed
]
- Murray IA, Hawkins AR, Keyte JW, Shaw WV: Nucleotide sequence analysis and overexpression of the gene encoding a type III chloramphenicol acetyltransferase. Biochem J. 1988 May 15;252(1):173-9. [PubMed
]
- Leslie AG, Moody PC, Shaw WV: Structure of chloramphenicol acetyltransferase at 1.75-A resolution. Proc Natl Acad Sci U S A. 1988 Jun;85(12):4133-7. [PubMed
]
|
| Target 5 Drug References |
- Derrick JP, Lian LY, Roberts GC, Shaw WV: Analysis of the binding of 1,3-diacetylchloramphenicol to chloramphenicol acetyltransferase by isotope-edited 1H NMR and site-directed mutagenesis. Biochemistry. 1992 Sep 8;31(35):8191-5. [PubMed
]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
- Murray IA, Lewendon A, Shaw WV: Stabilization of the imidazole ring of His-195 at the active site of chloramphenicol acetyltransferase. J Biol Chem. 1991 Jun 25;266(18):11695-8. [PubMed
]
- Murray IA, Cann PA, Day PJ, Derrick JP, Sutcliffe MJ, Shaw WV, Leslie AG: Steroid recognition by chloramphenicol acetyltransferase: engineering and structural analysis of a high affinity fusidic acid binding site. J Mol Biol. 1995 Dec 15;254(5):993-1005. [PubMed
]
|
|
Drug Target 6
[top]
|
| Target 6 ID |
2810 |
| Target 6 Name |
Dr hemagglutinin structural subunit |
| Target 6 Synonyms |
- Dr hemagglutinin structural subunit precursor
|
| Target 6 Gene Name |
draA |
| Target 6 Protein Sequence |
>Dr hemagglutinin structural subunit precursor
MKKLAIMAAASMVFAVSSAHAGFTPSGTTGTTKLTVTEECQVRVGDLTVAKTRGQLTDAA
PIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGV
FYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWAK
|
| Target 6 Number of Residues |
162 |
| Target 6 Molecular Weight |
17058 |
| Target 6 Theoretical pI |
7.25 |
| Target 6 GO Classification |
|
Function
|
binding
protein binding |
|
Process
|
| Not Available |
|
Component
|
| Not Available |
|
| Target 6 General Function |
Involved in protein binding |
| Target 6 Specific Function |
Hemagglutinins of uropathogenic E.coli mediate adherence to the upper urinary tract. These adhesins bind to the Dr blood group antigen and also agglutinate human erythrocytes in the presence of D-mannose (mannose-resistant hemagglutination (MRHA)) |
| Target 6 Pathways |
Not Available
|
| Target 6 Reactions |
Not Available |
| Target 6 Pfam Domain Function |
|
| Target 6 Signals |
|
| Target 6 Transmembrane Regions |
|
| Target 6 Essentiality |
Essential |
| Target 6 GenBank ID Protein |
145801  |
| Target 6 UniProtKB/Swiss-Prot ID |
P24093  |
| Target 6 UniProtKB/Swiss-Prot Entry Name |
FMDR_ECOLI  |
| Target 6 PDB ID |
1UT1  |
| Target 6 PDB File |
Show |
| Target 6 3D Structure |
|
| Target 6 Cellular Location |
|
| Target 6 Gene Sequence |
>483 bp
ATGAAAAAATTAGCGATCATGGCCGCGGCCAGCATGGTGTTCGCCGTGAGCTCCGCGCAT
GCTGGGTTCACCCCGAGTGGCACCACCGGCACCACCAAACTCACAGTTACCGAAGAGTGC
CAGGTACGGGTTGGTGACCTGACCGTGGCTAAGACTCGTGGCCAACTGACGGACGCAGCA
CCAATAGGGCCGGTCACCGTGCAAGCGCTGGGATGCGACGCCCGCCAGGTCGCGTTGAAG
GCAGACACCGATAACTTCGAACAGGGCAAGTTCTTCCTGATCAGCGACAACAATAGGGAT
AAGCTCTATGTCAATATACGGCCTACGGATAACTCCGCCTGGACGACCGACAATGGTGTC
TTCTACAAAAACGATGTCGGGAGCTGGGGTGGAATTATCGGGATCTACGTAGATGGGCAA
CAAACGAACACACCGCCCGGCAACTACACACTGACCCTGACCGGGGGTTACTGGGCAAAA
TGA
|
| Target 6 GenBank Gene ID |
|
| Target 6 GeneCard ID |
Not Available |
| Target 6 GenAtlas ID |
Not Available |
| Target 6 HGNC ID |
Not Available |
| Target 6 Chromosome Location |
Not Available |
| Target 6 Locus |
Not Available |
| Target 6 SNPs |
SNPJam Report  |
| Target 6 General References |
- Swanson TN, Bilge SS, Nowicki B, Moseley SL: Molecular structure of the Dr adhesin: nucleotide sequence and mapping of receptor-binding domain by use of fusion constructs. Infect Immun. 1991 Jan;59(1):261-8. [PubMed
]
- Kist ML, Salit IE, Hofmann T: Purification and characterization of the Dr hemagglutinins expressed by two uropathogenic Escherichia coli strains. Infect Immun. 1990 Mar;58(3):695-702. [PubMed
]
|
| Target 6 Drug References |
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
|