Banner
Identification
Name Salmon Calcitonin
Accession Number DB00017 (BIOD00025, BTD00025)
Type biotech
Groups approved
Description

Synthetic peptide, 32 residues long formulated as a nasal spray.
Protein structure No_structure_small
Protein chemical formula C145H240N44O48S2
Protein average weight 3431.8530
Sequences 
>DB00017 sequence
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP

FASTA
Synonyms
Calcitonin 1 precursor
Calcitonin-salmon
Calcitonin, salmon
Salmotonin
Salts Not Available
Brand names
Name Company
Calcimar
Miacalcin (Novartis)
Brand mixtures Not Available
Categories
  • Antiosteporotic Agents
  • Bone Density Conservation Agents
  • Antihypercalcemic agent
CAS number 47931-85-1
Taxonomy
Kingdom Not Available
Classes Not Available
Substructures Not Available
Pharmacology
Indication For the treatment of post-menopausal osteoporosis
Pharmacodynamics Calcitonin inhibits bone removal by osteoclasts (bone remodeling cells) and promotes bone formation by osteoblasts. This leads to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of action Calcitonin binds to the calcitonin receptor (found primarily in osteoclasts) which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Absorption Salmon calcitonin is rapidly absorbed and eliminated. Bioavailability following subcutaneous and intramuscular injection in humans is high and similar for the two routes of administration (71% and 66%, respectively).
Volume of distribution Not Available
Protein binding 30 to 40%
Metabolism Salmon calcitonin is primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
Route of elimination Studies with injectable calcitonin show increases in the excretion of filtered phosphate, calcium, and sodium by decreasing their tubular reabsorption in the kidney.
Half life 50-80 minutes
Clearance Not Available
Toxicity Salmon calcitonin is devoid of embryotoxic, teratogenic and mutagenic potential.
Affected organisms
  • Humans and other mammals
Pathways Not Available
Pharmacoeconomics
Manufacturers
  • Sanofi aventis us llc
  • Astrazeneca lp
  • Novartis pharmaceuticals corp
  • Apotex inc
  • Par pharmaceutical inc
  • Upsher smith laboratories inc
Packagers
Dosage forms
Form Route Strength
Liquid Intramuscular
Liquid Nasal
Solution Intramuscular
Solution Nasal
Prices
Unit description Cost Unit
Miacalcin 200 unit/act Solution 3.7ml Bottle 139.39 USD bottle
Calcitonin (Salmon) 200 unit/act Solution 3.7ml Bottle 123.28 USD bottle
Miacalcin For Inj, 2 unit = 1 Box 2ml Vial 63.59 USD vial
Miacalcin 200 unit nasal spray 44.68 USD ml
Calcitonin-salmon 200 unit sp 39.51 USD ml
Fortical 200 unit nasal spray 34.3 USD ml
Miacalcin 200 unit/ml vial 30.73 USD ml
Calcimar 200 iu/ml 29.94 USD ml
Caltine 100 (100 Iu/Ml) 100 iu/ml 8.81 USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Country Patent Number Approved Expires (estimated)
United States 6440392 2001-02-02 2021-02-02
United States 5733569 1995-03-31 2015-03-31
Properties
State liquid
Experimental Properties
Property Value Source
hydrophobicity -0.537 Not Available
isoelectric point 8.86 Not Available
References
Synthesis Reference Not Available
General Reference Not Available
External Links
Resource Link
UniProt P01263 Link_out
Genbank Y00765 Link_out
PharmGKB PA448715 Link_out
RxList http://www.rxlist.com/cgi/generic2/calcit.htm Link_out
Wikipedia http://en.wikipedia.org/wiki/Calcitonin Link_out
ATC Codes
  • H05BA01
AHFS Codes
  • 68:24.00
PDB Entries
FDA label Not Available
MSDS Not Available
Interactions
Drug Interactions Not Available
Food Interactions Not Available
Targets

1. Calcitonin receptor

Pharmacological action: unknown
Actions: agonist

This is a receptor for calcitonin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The calcitonin receptor is thought to couple to the heterotrimeric guanosine triphosphate-binding protein that is sensitive to cholera toxin

Organism class: human
UniProt ID: P30988 Link_out
Gene: CALCR Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Bouizar Z, Fouchereau-Peron M, Taboulet J, Moukhtar MS, Milhaud G: Purification and characterization of calcitonin receptors in rat kidney membranes by covalent cross-linking techniques. Eur J Biochem. 1986 Feb 17;155(1):141-7. Pubmed
  2. Stroop SD, Moore EE: Intracellular calcium increases mediated by a recombinant human calcitonin receptor. J Bone Miner Res. 1995 Apr;10(4):524-32. Pubmed
  3. Sarkar A, Dickerson IM: Cloning, characterization, and expression of a calcitonin receptor from guinea pig brain. J Neurochem. 1997 Aug;69(2):455-64. Pubmed
  4. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed
Comments
Drug created on June 13, 2005 07:24 / Updated on February 07, 2013 10:33