You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameSalmon Calcitonin
Accession NumberDB00017  (BTD00025, BIOD00025)
TypeBiotech
GroupsApproved, Investigational
Description

Synthetic peptide, 32 residues long formulated as a nasal spray.

Protein structureDb00017
Related Articles
Protein chemical formulaC145H240N44O48S2
Protein average weight3431.853 Da
Sequences
>DB00017 sequence
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Download FASTA Format
Synonyms
Calcimar
Calcitonin (Salmon Synthetic)
Calcitonin 1 precursor
Calcitonin Salmon
Calcitonin salmon recombinant
Calcitonin-salmon
Calcitonin, salmon
Cibacalcin
Fortical
Miacalcin
Salmon calcitonin
Salmotonin
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Calcimar Solution Inj 200unit/mlsolution200 unitintramuscular; subcutaneousSanofi Aventis Canada Inc1983-12-31Not applicableCanada
Calcitonin (salmon) Injection, BPsolution200 unitintramuscular; subcutaneousMylan Pharmaceuticals UlcNot applicableNot applicableCanada
Calcitonin Salmonspray, metered200 [iU]/1nasalSandoz Inc1995-08-01Not applicableUs
Caltine Inj 100 Unit/ml (1ml Amp)liquid100 unitintramuscular; subcutaneousFerring Inc1993-12-312014-07-25Canada
Caltine Inj 100unit/ml (0.5ml Amp)liquid100 unitintramuscular; subcutaneousFerring Inc1993-12-312002-01-30Canada
Forticalspray, metered2200 [iU]/mLnasalPhysicians Total Care, Inc.2005-12-30Not applicableUs
Forticalspray, metered2200 [iU]/mLnasalUpsher Smith Laboratories, Inc.2005-08-12Not applicableUs
Miacalcininjection, solution200 [iU]/mLintramuscular; subcutaneousNovartis Pharmaceuticals Corporation1986-07-03Not applicableUs
Miacalcininjection, solution200 [iU]/mLintramuscularSebela Pharmaceuticals Inc.1986-07-03Not applicableUs
Miacalcinspray, metered200 [iU]/1nasalNovartis Pharmaceuticals Corporation1995-08-01Not applicableUs
Miacalcin Injection 200iu/mlliquid200 unitintramuscular; intravenous; subcutaneousNovartis Pharmaceuticals Canada IncNot applicableNot applicableCanada
Miacalcin Nasal Spray 200 Iuspray200 unitnasalNovartis Pharmaceuticals Canada Inc1999-09-082013-10-01Canada
Pro-calcitonin - 200solution200 unitnasalPro Doc Limitee2008-07-042011-07-27Canada
Sandoz-calcitonin NSliquid200 unitnasalSandoz Canada Incorporated2004-12-012013-10-01Canada
Approved Generic Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Apo-calcitonin Injectableliquid200 unitintramuscular; subcutaneousApotex Inc2003-05-012013-08-02Canada
Apo-calcitonin Nasal Spraysolution200 unitnasalApotex Inc2003-09-122013-10-01Canada
Calcitonin Salmonspray, metered200 [iU]/.09mLnasalPar Pharmaceutical Inc. (Mgc)2009-06-08Not applicableUs
Calcitonin Salmonspray, metered200 [iU]/1nasalApotex Corp.2008-12-09Not applicableUs
Calcitonin Salmonspray, metered200 [iU]/.09mLnasalPhysicians Total Care, Inc.2011-12-09Not applicableUs
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
CalcimarNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNII7SFC6U2VI5
CAS number47931-85-1
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationUsed in the treatment of symptomatic Paget's disease for patients unresponsive to alternate treatments or intolerant to such treatments. In addition, it is used in emergency situations when serum calcium levels must be decreased quickly until the underlying condition is identified. It can also be added to existing therapeutic regimens for hypercalcemia such as intravenous fluids and furosemide, oral phosphate or corticosteroids, or other agents. Calcitonin can be used in patients with azotemia and cases where intravenous fluids would be contraindicated due to limited cardiac reserves. Also for the treatment of post-menopausal osteoporosis in women more than 5 years post-menopause.
PharmacodynamicsCalcitonin inhibits bone resorption by osteoclasts (bone remodeling cells) and promotes bone formation by osteoblasts. This leads to a net increase in bone mass and a reduction in plasma calcium levels. It also promotes the renal excretion of ions such as calcium, phosphate, sodium, magnesium, and potassium by decreasing tubular reabsorption. In consequence, there is an increase in the jejunal secretion of water, sodium, potassium, and chloride.
Mechanism of actionCalcitonin binds to the calcitonin receptor (found primarily in osteoclasts) which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
Related Articles
AbsorptionSalmon calcitonin is rapidly absorbed and eliminated. Bioavailability following subcutaneous and intramuscular injection in humans is high and similar for the two routes of administration (71% and 66%, respectively). Via the nasal route, the bioavailability varies between 3 to 5% relative to IM.
Volume of distribution

0.15 to 0.3 L/kg

Protein binding30 to 40%
Metabolism

Salmon calcitonin is primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. It is also metabolized in the blood and the peripheral tissue.

Route of eliminationUrine. Studies with injectable calcitonin show increases in the excretion of filtered phosphate, calcium, and sodium by decreasing their tubular reabsorption in the kidney.
Half lifeHalf-life elimination (terminal): I.M. 58 minutes; SubQ 59 to 64 minutes; Nasal: ~18 to 23 minutes
ClearanceNot Available
ToxicitySalmon calcitonin was shown to inhibit lactation in animals and is not recommend in nursing mothers. While research in animals have shown a decrease in fetal weight, no studies have yet shown similar results in humans. It is recommended however to proceed carefully when administering salmon calcitonin to pregnant women and consider if the benefits outweigh the risks. Because of its protein nature, salmon calcitonin may provoke an allergy reaction (bronchospams and swelling of the tongue/throat) that can turn into a full-blown anaphylactic response. The manufacturer also reports an increase in the risk of malignancies from oral route (0.7%) to intranasal route (2.4%) compared to placebo. The same may apply to IV, IM and SC routes since the systemic exposure is higher in those cases. Nausea is noticeable in some patients but tends to decrease with continued administration. Rhinitis, headaches and back pain have also been reported among others.
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
Manufacturers
  • Sanofi aventis us llc
  • Astrazeneca lp
  • Novartis pharmaceuticals corp
  • Apotex inc
  • Par pharmaceutical inc
  • Upsher smith laboratories inc
Packagers
Dosage forms
FormRouteStrength
Liquidintramuscular; subcutaneous200 unit
Solutionnasal200 unit
Solutionintramuscular; subcutaneous200 unit
Spray, meterednasal200 [iU]/.09mL
Liquidintramuscular; subcutaneous100 unit
Spray, meterednasal2200 [iU]/mL
Injection, solutionintramuscular200 [iU]/mL
Injection, solutionintramuscular; subcutaneous200 [iU]/mL
Spray, meterednasal200 [iU]/1
Liquidintramuscular; intravenous; subcutaneous200 unit
Spraynasal200 unit
Liquidnasal200 unit
Prices
Unit descriptionCostUnit
Miacalcin 200 unit/act Solution 3.7ml Bottle139.39USD bottle
Calcitonin (Salmon) 200 unit/act Solution 3.7ml Bottle123.28USD bottle
Miacalcin For Inj, 2 unit = 1 Box 2ml Vial63.59USD vial
Miacalcin 200 unit nasal spray44.68USD ml
Calcitonin-salmon 200 unit sp39.51USD ml
Fortical 200 unit nasal spray34.3USD ml
Miacalcin 200 unit/ml vial30.73USD ml
Calcimar 200 iu/ml29.94USD ml
Caltine 100 (100 Iu/Ml) 100 iu/ml8.81USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US5733569 No1995-03-312015-03-31Us
US6440392 No2001-02-022021-02-02Us
USRE40812 No2001-02-022021-02-02Us
USRE43580 No2001-02-022021-02-02Us
Properties
StateLiquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.537Not Available
isoelectric point8.86Not Available
References
Synthesis Reference

Marcos C. Poblet, Berta P. Obiols, Gemma J. Farres, “Procedure for preparing salmon calcitonin.” U.S. Patent US5527881, issued October, 1991.

US5527881
General ReferencesNot Available
External Links
ATC CodesH05BA01
AHFS Codes
  • 68:24.00
PDB Entries
FDA labelNot Available
MSDSNot Available
Interactions
Drug Interactions
Drug
LithiumThe serum concentration of Lithium can be decreased when it is combined with Salmon Calcitonin.
Zoledronic acidSalmon Calcitonin may increase the activities of Zoledronate.
Food InteractionsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
agonist
General Function:
Receptor activity
Specific Function:
This is a receptor for calcitonin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The calcitonin receptor is thought to couple to the heterotrimeric guanosine triphosphate-binding protein that is sensitive to cholera toxin.
Gene Name:
CALCR
Uniprot ID:
P30988
Molecular Weight:
59351.865 Da
References
  1. Bouizar Z, Fouchereau-Peron M, Taboulet J, Moukhtar MS, Milhaud G: Purification and characterization of calcitonin receptors in rat kidney membranes by covalent cross-linking techniques. Eur J Biochem. 1986 Feb 17;155(1):141-7. [PubMed:3004987 ]
  2. Stroop SD, Moore EE: Intracellular calcium increases mediated by a recombinant human calcitonin receptor. J Bone Miner Res. 1995 Apr;10(4):524-32. [PubMed:7610922 ]
  3. Sarkar A, Dickerson IM: Cloning, characterization, and expression of a calcitonin receptor from guinea pig brain. J Neurochem. 1997 Aug;69(2):455-64. [PubMed:9231703 ]
  4. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on July 26, 2016 01:52