| Identification | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Name | Menotropins | ||||||||||||||||
| Accession Number | DB00032 (BIOD00018, BTD00018) | ||||||||||||||||
| Type | biotech | ||||||||||||||||
| Groups | approved | ||||||||||||||||
| Description | Mixture of luteinizing hormone and follicle stimulating hormone extracted from the urine of postmeonopausal women. Composed of LH with 2 subunits, alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues |
||||||||||||||||
| Protein structure |
Display: 3D Structure |
||||||||||||||||
| Protein chemical formula | C1014H1609N287O294S27 | ||||||||||||||||
| Protein average weight | 23390.3000 | ||||||||||||||||
| Sequences |
>AlphaChain (LH) APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS >BetaChain (LH) SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYR DVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLF L >AlphaChain (FSH) APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS >BetaChain (FSH) NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYET VRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE FASTA |
||||||||||||||||
| Synonyms |
|
||||||||||||||||
| Salts | Not Available | ||||||||||||||||
| Brand names |
|
||||||||||||||||
| Brand mixtures | Not Available | ||||||||||||||||
| Categories |
|
||||||||||||||||
| CAS number | 61489-71-2 | ||||||||||||||||
| Taxonomy | |||||||||||||||||
| Kingdom | Not Available | ||||||||||||||||
| Classes | Not Available | ||||||||||||||||
| Substructures | Not Available | ||||||||||||||||
| Pharmacology | |||||||||||||||||
| Indication | For the treatment of female infertility | ||||||||||||||||
| Pharmacodynamics | Used to treat female infertility, Menotropins stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge. | ||||||||||||||||
| Mechanism of action | Being a combination drug, Menotropins bind to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and It also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle | ||||||||||||||||
| Absorption | Not Available | ||||||||||||||||
| Volume of distribution | Not Available | ||||||||||||||||
| Protein binding | Not Available | ||||||||||||||||
| Metabolism | Not Available | ||||||||||||||||
| Route of elimination | Not Available | ||||||||||||||||
| Half life | Not Available | ||||||||||||||||
| Clearance | Not Available | ||||||||||||||||
| Toxicity | Not Available | ||||||||||||||||
| Affected organisms |
|
||||||||||||||||
| Pathways | Not Available | ||||||||||||||||
| Pharmacoeconomics | |||||||||||||||||
| Manufacturers | Not Available | ||||||||||||||||
| Packagers | |||||||||||||||||
| Dosage forms |
|
||||||||||||||||
| Prices |
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational
purposes only.
|
||||||||||||||||
| Patents | Not Available | ||||||||||||||||
| Properties | |||||||||||||||||
| State | liquid | ||||||||||||||||
| Experimental Properties |
|
||||||||||||||||
| References | |||||||||||||||||
| Synthesis Reference | Not Available | ||||||||||||||||
| General Reference | Not Available | ||||||||||||||||
| External Links |
|
||||||||||||||||
| ATC Codes |
|
||||||||||||||||
| AHFS Codes |
|
||||||||||||||||
| PDB Entries | |||||||||||||||||
| FDA label | show (175 KB) | ||||||||||||||||
| MSDS | Not Available | ||||||||||||||||
| Interactions | |||||||||||||||||
| Drug Interactions | Searched, but no interactions found. | ||||||||||||||||
| Food Interactions | Not Available | ||||||||||||||||
| Targets |
|---|
|
1. Follicle-stimulating hormone receptor Pharmacological action: yesActions: binder Receptor for follicle-stimulating hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase Organism class: humanUniProt ID: P23945 ![]() Gene: FSHR ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
2. Lutropin-choriogonadotropic hormone receptor Pharmacological action: yesReceptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase Organism class: humanUniProt ID: P22888 ![]() Gene: LHCGR ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
|
| Comments |
|---|