| Identification | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Name | OspA lipoprotein | |||||||||
| Accession Number | DB00045 (BIOD00054, BTD00054) | |||||||||
| Type | biotech | |||||||||
| Groups | approved | |||||||||
| Description | Vaccine against Lyme disease that contains lipoprotein OspA, an outer surface protein of Borrelia burgdorferi sensu stricto ZS7, as expressed by Escherichia coli. Lipoprotein OspA is a single polypeptide chain of 257 amino acids with lipids covalently bonded to the N terminus. It is conjugated with alum (aluminum hydroxide) as an adjuvant. |
|||||||||
| Protein structure |
Display: 3D Structure |
|||||||||
| Protein chemical formula | C1198H2012N322O422S2 | |||||||||
| Protein average weight | 27743.1000 | |||||||||
| Sequences |
>DB00045 sequence CKQNVSSLDEKNSVSVDLPGEMNVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVL EGVKADKSKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGEVSEKI ITRADGTRLEYTEIKSDGSGKAKEVLKSYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGE VSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLE GSAVEITKLDEIKNALK FASTA |
|||||||||
| Synonyms |
|
|||||||||
| Salts | Not Available | |||||||||
| Brand names |
|
|||||||||
| Brand mixtures | Not Available | |||||||||
| Categories |
|
|||||||||
| CAS number | Not Available | |||||||||
| Taxonomy | ||||||||||
| Kingdom | Not Available | |||||||||
| Classes | Not Available | |||||||||
| Substructures | Not Available | |||||||||
| Pharmacology | ||||||||||
| Indication | For prophylactic treatment of Lyme Disease | |||||||||
| Pharmacodynamics | OspA lipoprotein is a single polypeptide chain of 270 amino acids. It is a vaccination used to prevent Lyme Disease. | |||||||||
| Mechanism of action | OspA lipoprotein, an outer surface protein of the bacteria Borrelia burgdorferi sensu stricto ZS7, is used to stimulate the production of specific antibodies against B. burgdorferi. It is used as a vaccination against Lyme Disease, a disease carried by ticks. | |||||||||
| Absorption | Not Available | |||||||||
| Volume of distribution | Not Available | |||||||||
| Protein binding | Not Available | |||||||||
| Metabolism |
Not Available
|
|||||||||
| Route of elimination | Not Available | |||||||||
| Half life | 1.2 hours (mammalian reticulocytes, in vitro). | |||||||||
| Clearance | Not Available | |||||||||
| Toxicity | Not Available | |||||||||
| Affected organisms |
|
|||||||||
| Pathways | Not Available | |||||||||
| Pharmacoeconomics | ||||||||||
| Manufacturers | Not Available | |||||||||
| Packagers | Not Available | |||||||||
| Dosage forms | Not Available | |||||||||
| Prices | Not Available | |||||||||
| Patents | Not Available | |||||||||
| Properties | ||||||||||
| State | liquid | |||||||||
| Experimental Properties |
|
|||||||||
| References | ||||||||||
| Synthesis Reference | Not Available | |||||||||
| General Reference | Not Available | |||||||||
| External Links |
|
|||||||||
| ATC Codes | Not Available | |||||||||
| AHFS Codes | Not Available | |||||||||
| PDB Entries | ||||||||||
| FDA label | Not Available | |||||||||
| MSDS | Not Available | |||||||||
| Interactions | ||||||||||
| Drug Interactions | Not Available | |||||||||
| Food Interactions | Not Available | |||||||||
| Targets |
|---|
|
Pharmacological action: yes
Actions: other/unknown Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Acts via MyD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. May also promote apoptosis in response to lipoproteins. Recognizes mycoplasmal macrophage-activating lipopeptide-2kD (MALP-2), soluble tuberculosis factor (STF), phenol-soluble modulin (PSM) and B.burgdorferi outer surface protein A lipoprotein (OspA-L) cooperatively with TLR6 Organism class: humanUniProt ID: O60603  Gene: TLR2 Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report References:
|
| Comments |
|---|
Drug created on June 13, 2005 07:24 / Updated on September 29, 2010 14:34