You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameInsulin Glargine
Accession NumberDB00047  (BTD00045, BIOD00045, DB01308)
TypeBiotech
GroupsApproved
DescriptionInsulin glargine is produced by recombinant DNA technology using a non-pathogenic laboratory strain of Escherichia coli (K12) as the production organism. It is an analogue of human insulin made by replacing the asparagine residue at position A21 of the A-chain with glycine and adding two arginines to the C-terminus (positions B31 and 32) of the B-chain. The resulting protein is soluble at pH 4 and forms microprecipitates at physiological pH 7.4. Small amounts of insulin glargine are slowly released from microprecipitates giving the drug a long duration of action (up to 24 hours) and no pronounced peak concentration.
Protein structureDb00047
Related Articles
Protein chemical formulaC267H404N72O78S6
Protein average weight6063.0 Da
Sequences
>A chain
GIVEQCCTSICSLYQLENYCG
>B chain
FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR
Download FASTA Format
Synonyms
Insulin Glargine (rDNA origin)
Insulin glargine recombinant
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
AbasaglarSolution for injection100 Units/mlSubcutaneous useEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarSolution for injection to 80 unit injection)100 Units/mlSubcutaneous useEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarSolution for injection100 Units/mlSubcutaneous useEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarSolution for injection100 Units/mlSubcutaneous useEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarSolution for injection100 Units/mlSubcutaneous useEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarSolution for injection100 Units/mlSubcutaneous useEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarSolution for injection100 Units/mlSubcutaneous useEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarSolution for injection100 Units/mlSubcutaneous useEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarSolution for injection100 Units/mlSubcutaneous useEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarSolution for injection100 Units/mlSubcutaneous useEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarSolution for injection100 Units/mlSubcutaneous useEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarSolution for injection100 Units/mlSubcutaneous useEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
AbasaglarSolution for injection100 Units/mlSubcutaneous useEli Lilly Regional Operations Gmb H2014-09-09Not applicableEu
Basaglarsolution100 unitsubcutaneousEli Lilly Canada Inc2015-12-18Not applicableCanada
Basaglarsolution100 unitsubcutaneousEli Lilly Canada Inc2015-12-18Not applicableCanada
Basaglarinjection, solution100 [iU]/mLsubcutaneousEli Lilly and Company2015-12-16Not applicableUs
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
Lantusinjection, solution100 [iU]/mLsubcutaneousDispensing Solutions, Inc.2009-09-23Not applicableUs
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
Lantussolution100 unitsubcutaneousSanofi Aventis Canada IncNot applicableNot applicableCanada
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
Lantusinjection, solution100 [iU]/mLsubcutaneousPhysicians Total Care, Inc.2002-06-04Not applicableUs
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
Lantusinjection, solution100 [iU]/mLsubcutaneousTYA Pharmaceuticals2009-09-23Not applicableUs
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
Lantussolution100 unitsubcutaneousSanofi Aventis Canada Inc2007-09-24Not applicableCanada
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
Lantussolution100 unitsubcutaneousSanofi Aventis Canada IncNot applicableNot applicableCanada
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
Lantusinjection, solution100 [iU]/mLsubcutaneousPhysicians Total Care, Inc.2007-04-04Not applicableUs
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
Lantussolution100 unitsubcutaneousSanofi Aventis Canada Inc2002-07-24Not applicableCanada
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
Lantusinjection, solution100 [iU]/mLsubcutaneousSanofi Aventis U.S. Llc2009-09-23Not applicableUs
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
Lantusinjection, solution100 [iU]/mLsubcutaneousPhysicians Total Care, Inc.2011-02-07Not applicableUs
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
Lantussolution100 unitsubcutaneousSanofi Aventis Canada Inc2006-05-04Not applicableCanada
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
Lantusinjection, solution100 [iU]/mLsubcutaneousREMEDYREPACK INC.2013-06-12Not applicableUs
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
LantusSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-09Not applicableEu
Lantus Solostarinjection, solution100 [iU]/mLsubcutaneousSanofi Aventis U.S. Llc2009-09-23Not applicableUs
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
Toujeoinjection, solution300 U/mLsubcutaneousSanofi Aventis U.S. Llc2015-02-25Not applicableUs
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection300 units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection300 units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection300 units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection300 units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
ToujeoSolution for injection100 Units/mlSubcutaneous useSanofi Aventis Deutschland Gmb H2000-06-27Not applicableEu
Toujeo Solostarsolution300 unitsubcutaneousSanofi Aventis Canada Inc2015-07-15Not applicableCanada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
Lantus OptiSet Not Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNII2ZM8CX04RZ
CAS number160337-95-1
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor the treatment of Type 1 or 2 diabetes mellitus in patients over 17 years old who require a long-acting (basal) insulin for the control of hyperglycemia. May be used in pediatric patients with Type 1 diabetes mellitus who require a long-acting (basal) insulin for glycemic control.
PharmacodynamicsInsulin is a natural hormone produced by beta cells of the pancreas. In non-diabetic individuals, a basal level of insulin is supplemented with insulin spikes following meals. Increased insulin secretion following meals is responsible for the metabolic changes that occur as the body transitions from a postabsorptive to absorptive state. Insulin promotes cellular uptake of glucose, particularly in muscle and adipose tissues, promotes energy storage via glycogenesis, opposes catabolism of energy stores, increases DNA replication and protein synthesis by stimulating amino acid uptake by liver, muscle and adipose tissue, and modifies the activity of numerous enzymes involved in glycogen synthesis and glycolysis. Insulin also promotes growth and is required for the actions of growth hormone (e.g. protein synthesis, cell division, DNA synthesis). Insulin glargine is a long-acting insulin analogue with a flat and predictable action profile. It is used to mimic the basal levels of insulin in diabetic individuals. The onset of action of insulin glargine is approximately 90 minutes and its duration of action is up to 24 hours. The action profile of insulin glargine is peakless. The significance of this finding is that insulin glargine has a lower chance of nocturnal hypoglycemia.
Mechanism of actionInsulin glargine binds to the insulin receptor (IR), a heterotetrameric protein consisting of two extracellular alpha units and two transmembrane beta units. The binding of insulin to the alpha subunit of IR stimulates the tyrosine kinase activity intrinsic to the beta subunit of the receptor. The bound receptor autophosphorylates and phosphorylates numerous intracellular substrates such as insulin receptor substrates (IRS) proteins, Cbl, APS, Shc and Gab 1. Activation of these proteins leads to the activation of downstream signaling molecules including PI3 kinase and Akt. Akt regulates the activity of glucose transporter 4 (GLUT4) and protein kinase C (PKC), both of which play critical roles in metabolism. Insulin glargine is completely soluble at pH 4, the pH of administered solution, and has low solubility at physiological pH 7.4. Upon subcuteous injection, the solution is neutralized resulting in the formation of microprecipitates. Small amounts of insulin glargine are released from microprecipitates giving the drug a relatively constant concentration over time profile over 24 hours with no pronounced peak. This release mechanism allows the drug to mimic basal insulin levels within the body.
Related Articles
AbsorptionBecause of the modifications to the A and B chain, the isoelectric point shifts towards a neutral pH and insulin glargine is more stable in acidic conditions than regular insulin. As insulin glargine is less soluble at neutral pH, once injected, forms microprecipitates. Slow release of insulin glargine from microprecipitates provides a relatively constant concentration of insulin over 24 hours. Onset of action is approximately 1.1 hours.
Volume of distributionNot Available
Protein bindingNot Available
Metabolism

Partly metabolized to two active metabolites with similar in vitro activity to insulin: A21-Gly-insulin and A21-Gly-des-B30-Thr-insulin.

SubstrateEnzymesProduct
Insulin Glargine
Not Available
A21-Gly-des-B30-Thr-insulinDetails
Insulin Glargine
Not Available
A21-Gly-insulinDetails
Route of eliminationNot Available
Half lifeNot reported in humans; 30 hours in vitro in mammalian reticulocytes.
ClearanceNot Available
ToxicityInappropriately high dosages relative to food intake and/or energy expenditure may result in severe and sometimes prolonged and life-threatening hypoglycemia. Neurogenic (autonomic) signs and symptoms of hypoglycemia include trembling, palpitations, sweating, anxiety, hunger, nausea and tingling. Neuroglycopenic signs and symptoms of hypoglycemia include difficulty concentrating, lethargy/weakness, confusion, drowsiness, vision changes, difficulty speaking, headache, and dizziness. Mild hypoglycemia is characterized by the presence of autonomic symptoms. Moderate hypoglycemia is characterized by the presence of autonomic and neuroglycopenic symptoms. Individuals may become unconscious in severe cases of hypoglycemia. Other adverse events that may occur include allergic reaction, injection site reaction, lipodystrophy, pruritis, and rash.
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
Manufacturers
  • Sanofi aventis us llc
Packagers
Dosage forms
FormRouteStrength
Solution for injectionSubcutaneous use100 Units/ml
Solution for injection to 80 unit injection)Subcutaneous use100 Units/ml
Solutionsubcutaneous100 unit
Injection, solutionsubcutaneous100 [iU]/mL
Injection, solutionsubcutaneous300 U/mL
Solution for injectionSubcutaneous use300 units/ml
Solutionsubcutaneous300 unit
Prices
Unit descriptionCostUnit
Lantus SoloStar 100 unit/ml Solution 1 Box = Five 3ml Syringes223.89USD box
Lantus 100 unit/ml Solution 10ml Vial111.88USD vial
Lantus for OptiClik 100 unit/ml Solution 3ml Cartridge44.78USD cartridge
Lantus 100 unit/ml cartridge14.35USD ml
Lantus solostar 100 unit/ml14.35USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1339044 No1997-04-012014-04-01Canada
US6100376 No1992-11-062009-11-06Us
US7476652 Yes2004-01-232024-01-23Us
US7713930 Yes2003-12-132023-12-13Us
US7918833 Yes2008-03-232028-03-23Us
US8512297 No2004-09-152024-09-15Us
US8556864 No2004-03-032024-03-03Us
US8603044 No2004-03-022024-03-02Us
US8679069 No2005-04-122025-04-12Us
US8992486 No2004-06-052024-06-05Us
US9011391 No2004-03-262024-03-26Us
US9233211 No2004-03-022024-03-02Us
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point81 °CKhachidze, D.G. et al., J. Biol. Phys. Chem. 1:64-67 (2001)
hydrophobicity0.098Not Available
isoelectric point6.88Not Available
References
Synthesis ReferenceNot Available
General References
  1. Chatterjee S, Tringham JR, Davies MJ: Insulin glargine and its place in the treatment of Types 1 and 2 diabetes mellitus. Expert Opin Pharmacother. 2006 Jul;7(10):1357-71. [PubMed:16805721 ]
  2. Dunn CJ, Plosker GL, Keating GM, McKeage K, Scott LJ: Insulin glargine: an updated review of its use in the management of diabetes mellitus. Drugs. 2003;63(16):1743-78. [PubMed:12904090 ]
  3. Home PD, Ashwell SG: An overview of insulin glargine. Diabetes Metab Res Rev. 2002 Sep-Oct;18 Suppl 3:S57-63. [PubMed:12324987 ]
  4. Jones R: Insulin glargine (Aventis Pharma). IDrugs. 2000 Sep;3(9):1081-7. [PubMed:16049868 ]
  5. Wang F, Carabino JM, Vergara CM: Insulin glargine: a systematic review of a long-acting insulin analogue. Clin Ther. 2003 Jun;25(6):1541-77, discussion 1539-40. [PubMed:12860485 ]
  6. Warren E, Weatherley-Jones E, Chilcott J, Beverley C: Systematic review and economic evaluation of a long-acting insulin analogue, insulin glargine. Health Technol Assess. 2004 Nov;8(45):iii, 1-57. [PubMed:15525480 ]
  7. Owens DR, Bolli GB: Beyond the era of NPH insulin--long-acting insulin analogs: chemistry, comparative pharmacology, and clinical application. Diabetes Technol Ther. 2008 Oct;10(5):333-49. doi: 10.1089/dia.2008.0023. [PubMed:18715209 ]
External Links
ATC CodesA10AE04
AHFS Codes
  • 68:20.08
PDB Entries
FDA labelDownload (51.2 KB)
MSDSNot Available
Interactions
Drug Interactions
Drug
7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE may increase the hypoglycemic activities of Insulin Glargine.
AcarboseAcarbose may increase the hypoglycemic activities of Insulin Glargine.
AcetohexamideAcetohexamide may increase the hypoglycemic activities of Insulin Glargine.
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Insulin Glargine.
AicarAicar may increase the hypoglycemic activities of Insulin Glargine.
AlogliptinAlogliptin may increase the hypoglycemic activities of Insulin Glargine.
Aminosalicylic AcidAminosalicylic Acid may increase the hypoglycemic activities of Insulin Glargine.
AmoxapineAmoxapine may increase the hypoglycemic activities of Insulin Glargine.
AripiprazoleThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Aripiprazole.
Arsenic trioxideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Arsenic trioxide.
ArticaineThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Articaine.
AsenapineThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Asenapine.
AtazanavirThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Atazanavir.
BendroflumethiazideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Bendroflumethiazide.
BenmoxinBenmoxin may increase the hypoglycemic activities of Insulin Glargine.
BetamethasoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Betamethasone.
BrexpiprazoleThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Brexpiprazole.
BuforminBuformin may increase the hypoglycemic activities of Insulin Glargine.
BumetanideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Bumetanide.
BuserelinThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Buserelin.
CanagliflozinCanagliflozin may increase the hypoglycemic activities of Insulin Glargine.
CaroxazoneCaroxazone may increase the hypoglycemic activities of Insulin Glargine.
CastanospermineCastanospermine may increase the hypoglycemic activities of Insulin Glargine.
CeritinibThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Ceritinib.
ChlorothiazideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Chlorothiazide.
ChlorpropamideInsulin Glargine may increase the hypoglycemic activities of Chlorpropamide.
ChlorthalidoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Chlorthalidone.
CiglitazoneCiglitazone may increase the hypoglycemic activities of Insulin Glargine.
CitalopramCitalopram may increase the hypoglycemic activities of Insulin Glargine.
ClomipramineClomipramine may increase the hypoglycemic activities of Insulin Glargine.
ClozapineThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Clozapine.
CorticotropinThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Corticotropin.
Cortisone acetateThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Cortisone acetate.
Cyproterone acetateThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Cyproterone acetate.
DabrafenibThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Dabrafenib.
DanazolThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Danazol.
DapoxetineDapoxetine may increase the hypoglycemic activities of Insulin Glargine.
DarunavirThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Darunavir.
DesogestrelThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Desogestrel.
DexamethasoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Dexamethasone.
DiazoxideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Diazoxide.
DienogestThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Dienogest.
DiflunisalDiflunisal may increase the hypoglycemic activities of Insulin Glargine.
DihydrotestosteroneDihydrotestosterone may increase the hypoglycemic activities of Insulin Glargine.
DisopyramideInsulin Glargine may increase the hypoglycemic activities of Disopyramide.
DrospirenoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Drospirenone.
DulaglutideDulaglutide may increase the hypoglycemic activities of Insulin Glargine.
EmpagliflozinEmpagliflozin may increase the hypoglycemic activities of Insulin Glargine.
EpinephrineThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Epinephrine.
EscitalopramEscitalopram may increase the hypoglycemic activities of Insulin Glargine.
EstradiolThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Estradiol.
Estrone sulfateThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Estrone sulfate.
Etacrynic acidThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Etacrynic acid.
Ethinyl EstradiolThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Ethinyl Estradiol.
Ethynodiol diacetateThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Ethynodiol diacetate.
EtonogestrelThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Etonogestrel.
EtoperidoneEtoperidone may increase the hypoglycemic activities of Insulin Glargine.
EverolimusThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Everolimus.
ExenatideExenatide may increase the hypoglycemic activities of Insulin Glargine.
FenfluramineFenfluramine may increase the hypoglycemic activities of Insulin Glargine.
FludrocortisoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Fludrocortisone.
FluoxetineFluoxetine may increase the hypoglycemic activities of Insulin Glargine.
FluoxymesteroneFluoxymesterone may increase the hypoglycemic activities of Insulin Glargine.
FluvoxamineFluvoxamine may increase the hypoglycemic activities of Insulin Glargine.
FosamprenavirThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Fosamprenavir.
FurazolidoneFurazolidone may increase the hypoglycemic activities of Insulin Glargine.
FurosemideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Furosemide.
GlibornurideGlibornuride may increase the hypoglycemic activities of Insulin Glargine.
GliclazideInsulin Glargine may increase the hypoglycemic activities of Gliclazide.
GlimepirideInsulin Glargine may increase the hypoglycemic activities of Glimepiride.
GlipizideInsulin Glargine may increase the hypoglycemic activities of Glipizide.
GliquidoneGliquidone may increase the hypoglycemic activities of Insulin Glargine.
GlyburideInsulin Glargine may increase the hypoglycemic activities of Glyburide.
GoserelinThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Goserelin.
HistrelinThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Histrelin.
HydracarbazineHydracarbazine may increase the hypoglycemic activities of Insulin Glargine.
HydrochlorothiazideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Hydrochlorothiazide.
HydrocortisoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Hydrocortisone.
HydroflumethiazideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Hydroflumethiazide.
Hydroxyprogesterone caproateThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Hydroxyprogesterone caproate.
IloperidoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Iloperidone.
IndalpineIndalpine may increase the hypoglycemic activities of Insulin Glargine.
IndapamideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Indapamide.
IndinavirThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Indinavir.
Insulin AspartInsulin Glargine may increase the hypoglycemic activities of Insulin Aspart.
Insulin DetemirInsulin Glargine may increase the hypoglycemic activities of Insulin Detemir.
Insulin GlulisineInsulin Glargine may increase the hypoglycemic activities of Insulin Glulisine.
Insulin HumanInsulin Glargine may increase the hypoglycemic activities of Insulin Human.
Insulin LisproInsulin Lispro may increase the hypoglycemic activities of Insulin Glargine.
Insulin PorkInsulin Pork may increase the hypoglycemic activities of Insulin Glargine.
IproclozideIproclozide may increase the hypoglycemic activities of Insulin Glargine.
IproniazidIproniazid may increase the hypoglycemic activities of Insulin Glargine.
IsocarboxazidIsocarboxazid may increase the hypoglycemic activities of Insulin Glargine.
LanreotideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Lanreotide.
LanreotideInsulin Glargine may increase the hypoglycemic activities of Lanreotide.
LeuprolideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Leuprolide.
LevomilnacipranLevomilnacipran may increase the hypoglycemic activities of Insulin Glargine.
LevonorgestrelThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Levonorgestrel.
LinagliptinLinagliptin may increase the hypoglycemic activities of Insulin Glargine.
Lipoic AcidLipoic Acid may increase the hypoglycemic activities of Insulin Glargine.
LiraglutideLiraglutide may increase the hypoglycemic activities of Insulin Glargine.
LopinavirThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Lopinavir.
Lu AA21004Lu AA21004 may increase the hypoglycemic activities of Insulin Glargine.
LurasidoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Lurasidone.
MebanazineMebanazine may increase the hypoglycemic activities of Insulin Glargine.
MecaserminInsulin Glargine may increase the hypoglycemic activities of Mecasermin.
Medroxyprogesterone acetateThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Medroxyprogesterone acetate.
Megestrol acetateThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Megestrol acetate.
MesalazineMesalazine may increase the hypoglycemic activities of Insulin Glargine.
MestranolThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Mestranol.
MetforminMetformin may increase the hypoglycemic activities of Insulin Glargine.
MethotrimeprazineThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Methotrimeprazine.
MethyclothiazideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Methyclothiazide.
Methylene blueMethylene blue may increase the hypoglycemic activities of Insulin Glargine.
MethylprednisoloneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Methylprednisolone.
MethyltestosteroneMethyltestosterone may increase the hypoglycemic activities of Insulin Glargine.
MetolazoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Metolazone.
MifepristoneInsulin Glargine may increase the hypoglycemic activities of Mifepristone.
MiglitolMiglitol may increase the hypoglycemic activities of Insulin Glargine.
MiglustatMiglustat may increase the hypoglycemic activities of Insulin Glargine.
MilnacipranMilnacipran may increase the hypoglycemic activities of Insulin Glargine.
MinaprineMinaprine may increase the hypoglycemic activities of Insulin Glargine.
MitiglinideMitiglinide may increase the hypoglycemic activities of Insulin Glargine.
MoclobemideMoclobemide may increase the hypoglycemic activities of Insulin Glargine.
NateglinideInsulin Glargine may increase the hypoglycemic activities of Nateglinide.
NelfinavirThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Nelfinavir.
NiacinThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Niacin.
NialamideNialamide may increase the hypoglycemic activities of Insulin Glargine.
NilotinibThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Nilotinib.
NorethisteroneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Norethisterone.
NorgestimateThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Norgestimate.
OctamoxinOctamoxin may increase the hypoglycemic activities of Insulin Glargine.
OctreotideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Octreotide.
OctreotideInsulin Glargine may increase the hypoglycemic activities of Octreotide.
OlanzapineOlanzapine may increase the hypoglycemic activities of Insulin Glargine.
OxandroloneOxandrolone may increase the hypoglycemic activities of Insulin Glargine.
OxymetholoneOxymetholone may increase the hypoglycemic activities of Insulin Glargine.
PaliperidoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Paliperidone.
PargylinePargyline may increase the hypoglycemic activities of Insulin Glargine.
ParoxetineParoxetine may increase the hypoglycemic activities of Insulin Glargine.
PasireotideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Pasireotide.
PasireotideInsulin Glargine may increase the hypoglycemic activities of Pasireotide.
PegvisomantPegvisomant may increase the hypoglycemic activities of Insulin Glargine.
PentamidineThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Pentamidine.
PentamidineInsulin Glargine may increase the hypoglycemic activities of Pentamidine.
PhenelzinePhenelzine may increase the hypoglycemic activities of Insulin Glargine.
PhenforminPhenformin may increase the hypoglycemic activities of Insulin Glargine.
PheniprazinePheniprazine may increase the hypoglycemic activities of Insulin Glargine.
PhenoxypropazinePhenoxypropazine may increase the hypoglycemic activities of Insulin Glargine.
PioglitazonePioglitazone may increase the hypoglycemic activities of Insulin Glargine.
PiperazineThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Piperazine.
PipotiazineThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Pipotiazine.
PirlindolePirlindole may increase the hypoglycemic activities of Insulin Glargine.
PivhydrazinePivhydrazine may increase the hypoglycemic activities of Insulin Glargine.
PolythiazideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Polythiazide.
PramlintidePramlintide may increase the hypoglycemic activities of Insulin Glargine.
PrednisoloneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Prednisolone.
PrednisoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Prednisone.
ProgesteroneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Progesterone.
QuetiapineThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Quetiapine.
QuinethazoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Quinethazone.
QuinineInsulin Glargine may increase the hypoglycemic activities of Quinine.
RasagilineRasagiline may increase the hypoglycemic activities of Insulin Glargine.
RepaglinideInsulin Glargine may increase the hypoglycemic activities of Repaglinide.
RisperidoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Risperidone.
RitonavirThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Ritonavir.
RosiglitazoneRosiglitazone may increase the hypoglycemic activities of Insulin Glargine.
SafrazineSafrazine may increase the hypoglycemic activities of Insulin Glargine.
Salicylic acidSalicylic acid may increase the hypoglycemic activities of Insulin Glargine.
SaquinavirThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Saquinavir.
SaxagliptinSaxagliptin may increase the hypoglycemic activities of Insulin Glargine.
SelegilineSelegiline may increase the hypoglycemic activities of Insulin Glargine.
SertralineSertraline may increase the hypoglycemic activities of Insulin Glargine.
SirolimusThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Sirolimus.
SitagliptinSitagliptin may increase the hypoglycemic activities of Insulin Glargine.
StanozololStanozolol may increase the hypoglycemic activities of Insulin Glargine.
SulfadiazineInsulin Glargine may increase the hypoglycemic activities of Sulfadiazine.
SulfamethoxazoleInsulin Glargine may increase the hypoglycemic activities of Sulfamethoxazole.
SulfisoxazoleInsulin Glargine may increase the hypoglycemic activities of Sulfisoxazole.
SulodexideSulodexide may increase the hypoglycemic activities of Insulin Glargine.
SunitinibInsulin Glargine may increase the hypoglycemic activities of Sunitinib.
TacrolimusThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Tacrolimus.
TemsirolimusThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Temsirolimus.
TestosteroneTestosterone may increase the hypoglycemic activities of Insulin Glargine.
TipranavirThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Tipranavir.
TolazamideInsulin Glargine may increase the hypoglycemic activities of Tolazamide.
TolbutamideInsulin Glargine may increase the hypoglycemic activities of Tolbutamide.
ToloxatoneToloxatone may increase the hypoglycemic activities of Insulin Glargine.
TorasemideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Torasemide.
Trans-2-PhenylcyclopropylamineTrans-2-Phenylcyclopropylamine may increase the hypoglycemic activities of Insulin Glargine.
TranylcypromineTranylcypromine may increase the hypoglycemic activities of Insulin Glargine.
TrazodoneTrazodone may increase the hypoglycemic activities of Insulin Glargine.
TriamcinoloneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Triamcinolone.
TrichlormethiazideThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Trichlormethiazide.
TriptorelinThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Triptorelin.
TroglitazoneTroglitazone may increase the hypoglycemic activities of Insulin Glargine.
VilazodoneVilazodone may increase the hypoglycemic activities of Insulin Glargine.
VildagliptinVildagliptin may increase the hypoglycemic activities of Insulin Glargine.
VogliboseVoglibose may increase the hypoglycemic activities of Insulin Glargine.
VorinostatThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Vorinostat.
VortioxetineVortioxetine may increase the hypoglycemic activities of Insulin Glargine.
ZimelidineZimelidine may increase the hypoglycemic activities of Insulin Glargine.
ZiprasidoneThe therapeutic efficacy of Insulin Glargine can be decreased when used in combination with Ziprasidone.
Food InteractionsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Receptor signaling protein tyrosine kinase activity
Specific Function:
Receptor tyrosine kinase which mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (IRS1, 2, 3, 4), SHC, GAB1, CBL and other signaling intermediates. Each of these phosphorylated proteins serve as docking proteins for other signaling proteins that contain Src-homology-2 domains (SH2 ...
Gene Name:
INSR
Uniprot ID:
P06213
Molecular Weight:
156331.465 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
  2. Le Roith D: Insulin glargine and receptor-mediated signalling: clinical implications in treating type 2 diabetes. Diabetes Metab Res Rev. 2007 Nov;23(8):593-9. [PubMed:17922476 ]
  3. Sciacca L, Cassarino MF, Genua M, Pandini G, Le Moli R, Squatrito S, Vigneri R: Insulin analogues differently activate insulin receptor isoforms and post-receptor signalling. Diabetologia. 2010 Aug;53(8):1743-53. doi: 10.1007/s00125-010-1760-6. Epub 2010 Apr 28. [PubMed:20424816 ]
  4. Wada T, Azegami M, Sugiyama M, Tsuneki H, Sasaoka T: Characteristics of signalling properties mediated by long-acting insulin analogue glargine and detemir in target cells of insulin. Diabetes Res Clin Pract. 2008 Sep;81(3):269-77. doi: 10.1016/j.diabres.2008.05.007. Epub 2008 Jun 27. [PubMed:18585815 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
agonist
General Function:
Protein tyrosine kinase activity
Specific Function:
Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation,...
Gene Name:
IGF1R
Uniprot ID:
P08069
Molecular Weight:
154791.73 Da
References
  1. Smith TJ: Insulin-like growth factor-I regulation of immune function: a potential therapeutic target in autoimmune diseases? Pharmacol Rev. 2010 Jun;62(2):199-236. doi: 10.1124/pr.109.002469. Epub 2010 Apr 14. [PubMed:20392809 ]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
inducer
General Function:
Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
Specific Function:
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Most active in catalyzing 2-hydroxylation. Caffeine is metabolized primarily by cytochrome CYP1A2 in the liver through an initial N...
Gene Name:
CYP1A2
Uniprot ID:
P05177
Molecular Weight:
58293.76 Da
References
  1. Drug Interactions: Cytochrome P450 Drug Interaction Table [Link]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on September 28, 2016 03:41