Welcome to DrugBank 4.0! If you prefer, you can still go back to version 3.0.
Identification
NameInterferon beta-1a
Accession NumberDB00060  (BIOD00093, BTD00093)
Typebiotech
Groupsapproved, investigational
Description

Human interferon beta (166 residues), glycosylated, MW=22.5kD. It is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.

Protein structureDb00060
Protein chemical formulaC908H1408N246O252S7
Protein average weight20027.0000
Sequences
>DB00060 sequence
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIY
EMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSL
HLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Download FASTA Format
Synonyms
SynonymLanguageCode
Fibroblast interferonNot AvailableNot Available
IFN-betaNot AvailableNot Available
Interferon beta precursorNot AvailableNot Available
SaltsNot Available
Brand names
NameCompany
AvonexBiogen Inc
Brand mixturesNot Available
Categories
CAS number145258-61-3
Taxonomy
KingdomOrganic Compounds
SuperclassOrganic Acids
ClassCarboxylic Acids and Derivatives
SubclassAmino Acids, Peptides, and Analogues
Direct parentPeptides
Alternative parentsNot Available
SubstituentsNot Available
Classification descriptionNot Available
Pharmacology
IndicationFor treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
PharmacodynamicsInterferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of actionInterferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
Metabolism
Route of eliminationNot Available
Half life10 hrs
Clearance
  • 33-55 L/hour [Healthy SC injection of 60 mcg]
ToxicityNot Available
Affected organismsNot Available
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
ADMET
Predicted ADMET features
Property Value Probability
Human Intestinal Absorption Not Available Not Available
Blood Brain Barrier Not Available Not Available
Caco-2 permeable Not Available Not Available
P-glycoprotein substrate Not Available Not Available
P-glycoprotein inhibitor I Not Available Not Available
P-glycoprotein inhibitor II Not Available Not Available
Renal organic cation transporter Not Available Not Available
CYP450 2C9 substrate Not Available Not Available
CYP450 2D6 substrate Not Available Not Available
CYP450 3A4 substrate Not Available Not Available
CYP450 1A2 substrate Not Available Not Available
CYP450 2C9 substrate Not Available Not Available
CYP450 2D6 substrate Not Available Not Available
CYP450 2C19 substrate Not Available Not Available
CYP450 3A4 substrate Not Available Not Available
CYP450 inhibitory promiscuity Not Available Not Available
Ames test Not Available Not Available
Carcinogenicity Not Available Not Available
Biodegradation Not Available Not Available
Rat acute toxicity Not Available Not applicable
hERG inhibition (predictor I) Not Available Not Available
hERG inhibition (predictor II) Not Available Not Available
Pharmacoeconomics
Manufacturers
  • Biogen Idec
Packagers
Dosage forms
FormRouteStrength
LiquidSubcutaneous
SolutionIntramuscular
Prices
Unit descriptionCostUnit
Avonex 4 30 mcg/vial Kit 1 Box = 4 Vials ( 0.5ml Per Vial)3252.29USDbox
Avonex Prefilled (1 Box = 1 Kit = Four 30 mcg/0.5ml Syringes) Box3252.29USDbox
Avonex admin pack 30 mcg vial781.8USDvial
Rebif 22 mcg/0.5 ml syringe247.79USDsyringe
Rebif 44 mcg/0.5 ml syringe247.79USDsyringe
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
CountryPatent NumberApprovedExpires (estimated)
Canada13416042010-05-042027-05-04
Properties
Stateliquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.427Not Available
isoelectric point8.93Not Available
Spectra
SpectraNot Available
References
Synthesis Reference

Heinz-Jurgen Friesen, Sidney Pestka, “Preparation of homogeneous human fibroblast interferon.” U.S. Patent US4289689, issued December, 1968.

US4289689
General ReferenceNot Available
External Links
ResourceLink
UniProtP01574
GenbankV00534
PharmGKBPA450037
Drug Product Database2237319
RxListhttp://www.rxlist.com/cgi/generic3/rebif.htm
Drugs.comhttp://www.drugs.com/cdi/interferon-beta-1a.html
WikipediaInterferon_beta-1a
ATC CodesL04AA23L03AB07
AHFS Codes
  • 92:00.00
PDB Entries
FDA labelshow(63 KB)
MSDSNot Available
Interactions
Drug InteractionsNot Available
Food InteractionsNot Available

1. Interferon alpha/beta receptor 1

Kind: protein

Organism: Human

Pharmacological action: yes

Actions: agonist

Components

Name UniProt ID Details
Interferon alpha/beta receptor 1 P17181 Details

References:

  1. Russell-Harde D, Wagner TC, Perez HD, Croze E: Formation of a uniquely stable type I interferon receptor complex by interferon beta is dependent upon particular interactions between interferon beta and its receptor and independent of tyrosine phosphorylation. Biochem Biophys Res Commun. 1999 Feb 16;255(2):539-44. Pubmed
  2. van Koetsveld PM, Vitale G, de Herder WW, Feelders RA, van der Wansem K, Waaijers M, van Eijck CH, Speel EJ, Croze E, van der Lely AJ, Lamberts SW, Hofland LJ: Potent inhibitory effects of type I interferons on human adrenocortical carcinoma cell growth. J Clin Endocrinol Metab. 2006 Nov;91(11):4537-43. Epub 2006 Aug 15. Pubmed
  3. Dupont SA, Goelz S, Goyal J, Green M: Mechanisms for regulation of cellular responsiveness to human IFN-beta1a. J Interferon Cytokine Res. 2002 Apr;22(4):491-501. Pubmed
  4. Runkel L, De Dios C, Karpusas M, Baker D, Li Z, Zafari M, Betzenhauser M, Muldowney C, Miller S, Redlich PN, Grossberg SE, Whitty A, Hochman PS: Mapping of IFN-beta epitopes important for receptor binding and biologic activation: comparison of results achieved using antibody-based methods and alanine substitution mutagenesis. J Interferon Cytokine Res. 2001 Nov;21(11):931-41. Pubmed

2. Interferon alpha/beta receptor 2

Kind: protein

Organism: Human

Pharmacological action: yes

Components

Name UniProt ID Details
Interferon alpha/beta receptor 2 P48551 Details

References:

  1. van Koetsveld PM, Vitale G, de Herder WW, Feelders RA, van der Wansem K, Waaijers M, van Eijck CH, Speel EJ, Croze E, van der Lely AJ, Lamberts SW, Hofland LJ: Potent inhibitory effects of type I interferons on human adrenocortical carcinoma cell growth. J Clin Endocrinol Metab. 2006 Nov;91(11):4537-43. Epub 2006 Aug 15. Pubmed
  2. Runkel L, De Dios C, Karpusas M, Baker D, Li Z, Zafari M, Betzenhauser M, Muldowney C, Miller S, Redlich PN, Grossberg SE, Whitty A, Hochman PS: Mapping of IFN-beta epitopes important for receptor binding and biologic activation: comparison of results achieved using antibody-based methods and alanine substitution mutagenesis. J Interferon Cytokine Res. 2001 Nov;21(11):931-41. Pubmed

Comments
Drug created on June 13, 2005 07:24 / Updated on September 13, 2013 10:48