| Version |
2.5 |
| Creation Date |
2005-06-13 13:24:05 |
| Update Date |
2009-02-19 16:03:23 |
| Primary Accession Number |
DB00060 |
| Secondary Accession Number |
|
| Name |
Interferon beta-1a |
| Drug Type |
- Approved
- Biotech
- Investigational
|
| Description |
Human interferon beta (166 residues), glycosylated, MW=22.5kD. It is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta. |
| Synonyms |
- Fibroblast interferon
- IFN-beta
- Interferon beta precursor
|
| Brand Names |
- Avonex (Biogen Inc)
- Belerofon
|
| Brand Mixtures |
Not Available |
| Chemical IUPAC Name |
Human interferon beta |
| Chemical Formula |
C908H1408N246O252S7 |
| Chemical Structure |
 |
| Protein Sequence(s) |
>DB00060 sequence
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIY
EMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSL
HLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
|
| CAS Registry Number |
145258-61-3 |
| InChI Identifier |
Not Available |
| InChI Key |
Not Available |
| KEGG Drug |
Not Available |
| KEGG Compound |
Not Available |
| PubChem Compound |
Not Available |
| PubChem Substance |
Not Available |
| ChEBI ID |
Not Available |
| PharmGKB ID |
PA10351  |
| HET ID |
Not Available |
| GenBank ID |
V00534 |
| Drug ID Number [DIN] |
02237319 |
| RxList Link |
http://www.rxlist.com/cgi/generic3/rebif.htm |
| PDRhealth Link |
Not Available |
| Wikipedia Link |
http://en.wikipedia.org/wiki/Interferon_beta-1a |
| FDA Label |
|
| Material Safety Data Sheet (MSDS) |
Not Available |
| Synthesis Reference |
Not Available |
| Average Molecular Weight |
20027.0000 |
| Monoisotopic Molecular Weight |
Not Available |
| State |
Liquid |
| Melting Point |
Not Available |
| Experimental Water Solubility |
Not Available
Source: PhysProp
|
| Predicted Water Solubility |
Not Available
Calculated using ALOGPS
|
| Experimental LogP/Hydrophobicity |
-0.427
Source: PhysProp
|
| Predicted LogP |
Not Available
Calculated using ALOGPS
|
| Experimental LogS |
Not Available |
| Predicted LogS |
Not Available
Calculated using ALOGPS
|
| Experimental Caco2 Permeability |
Not Available |
| pKa/Isoelectric Point |
8.93 |
| Mass Spectrum |
Not Available
|
| MOL File |
Not Available |
| SDF File |
Not Available |
| PDB File |
Not Available |
| Experimental PDB ID |
1AU1 |
| Experimental PDB File |
Show |
| Experimental PDB Structure |
|
| Isomeric SMILES |
Not Available |
| Canonical SMILES |
Not Available |
| Drug Category |
- Antiviral Agents
- Immunomodulatory Agents
|
| ATC Codes |
|
| AHFS Codes |
|
| Indication |
For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum |
| Pharmacology |
Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin. |
| Mechanism of Action |
Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha. |
| Absorption |
Not Available |
| Toxicity |
Not Available |
| Protein Binding |
Not Available |
| Biotransformation |
Not Available |
| Half Life |
10 hrs |
| Dosage Forms |
| Form |
Route |
| Liquid |
Subcutaneous |
| Solution |
Intramuscular |
|
| Patient Information |
Not Available |
| Contraindications |
Show |
| Interactions |
Show |
| Drug Interactions |
Not Available
|
| Food Interactions |
Not Available
|
| Pathways |
Not Available
|
| General References |
- Wikipedia
- RxList
|
| Organisms Affected |
Not Available |
