You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameInterferon beta-1a
Accession NumberDB00060  (BIOD00093, BTD00093)
TypeBiotech
GroupsApproved, Investigational
Description

Human interferon beta (166 residues), glycosylated, MW=22.5kD. It is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence is identical to that of natural human interferon beta.

Protein structureDb00060
Protein chemical formulaC908H1408N246O252S7
Protein average weight20027.0 Da
Sequences
>DB00060 sequence
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIY
EMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSL
HLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Download FASTA Format
Synonyms
Fibroblast interferon
IFN-beta
Interferon beta precursor
External Identifiers Not Available
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
AvonexkitintramuscularBiogen Idec Inc.2014-08-29Not applicableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Avonexsolution30 mcgintramuscularBiogen Canada Inc2005-12-02Not applicableCanada 5f16b84899037e23705f146ff57e3794121879cb055f0954756d94bc690476b4
AvonexkitintramuscularBiogen Idec Inc.2014-08-29Not applicableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Avonexinjection, solution30 ug/.5mLintramuscularBiogen Idec Inc.2003-05-232015-12-29Us 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Avonexinjection, powder, lyophilized, for solution30 ug/mLintramuscularBiogen Idec Inc.1996-05-172015-12-29Us 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Avonexpowder for solution60 mcgintramuscularBiogen Canada IncNot applicableNot applicableCanada 5f16b84899037e23705f146ff57e3794121879cb055f0954756d94bc690476b4
AvonexkitintramuscularBiogen Idec Inc.2014-08-29Not applicableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Avonex Peninjection, solution30 ug/.5mLintramuscularBiogen Idec Inc.2003-05-232015-12-29Us 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Rebifsolution8.8 mcgsubcutaneousEmd Serono A Division Of Emd Inc Canada2006-05-302013-08-09Canada 5f16b84899037e23705f146ff57e3794121879cb055f0954756d94bc690476b4
Rebifinjection, solution22 ug/.5mLsubcutaneousEMD Serono, Inc.2002-03-07Not applicableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Rebifsolution44 mcgsubcutaneousEmd Serono A Division Of Emd Inc Canada1998-02-24Not applicableCanada 5f16b84899037e23705f146ff57e3794121879cb055f0954756d94bc690476b4
RebifkitsubcutaneousEMD Serono, Inc.2004-12-17Not applicableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Rebifsolution22 mcgsubcutaneousEmd Serono A Division Of Emd Inc Canada1998-02-23Not applicableCanada 5f16b84899037e23705f146ff57e3794121879cb055f0954756d94bc690476b4
Rebifsolution132 mcgsubcutaneousEmd Serono A Division Of Emd Inc CanadaNot applicableNot applicableCanada 5f16b84899037e23705f146ff57e3794121879cb055f0954756d94bc690476b4
Rebifsolution132 mcgsubcutaneousEmd Serono A Division Of Emd Inc Canada2009-05-14Not applicableCanada 5f16b84899037e23705f146ff57e3794121879cb055f0954756d94bc690476b4
Rebifinjection, solution44 ug/.5mLsubcutaneousEMD Serono, Inc.2002-03-07Not applicableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Rebifsolution66 mcgsubcutaneousEmd Serono A Division Of Emd Inc Canada2009-05-14Not applicableCanada 5f16b84899037e23705f146ff57e3794121879cb055f0954756d94bc690476b4
Rebif Rebidoseinjection, solution44 ug/.5mLsubcutaneousEMD Serono, Inc.2012-12-21Not applicableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Rebif Rebidoseinjection, solution22 ug/.5mLsubcutaneousEMD Serono, Inc.2012-12-21Not applicableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Rebif RebidosekitsubcutaneousEMD Serono, Inc.2012-12-21Not applicableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Generic Prescription ProductsNot Available
Over the Counter ProductsNot Available
International Brands
NameCompany
BetaferonBayer
BlastoferonSidus
UribetaProbiomed
Brand mixtures
NameLabellerIngredients
AvonexBiogen Canada Inc
RebifEmd Serono A Division Of Emd Inc Canada
SaltsNot Available
Categories
CAS number145258-61-3
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
PharmacodynamicsInterferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of actionInterferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half life10 hrs
Clearance
  • 33-55 L/hour [Healthy SC injection of 60 mcg]
ToxicityNot Available
Affected organismsNot Available
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
Manufacturers
  • Biogen Idec
Packagers
Dosage forms
FormRouteStrength
Injection, powder, lyophilized, for solutionintramuscular30 ug/mL
Injection, solutionintramuscular30 ug/.5mL
Kitintramuscular
Powder for solutionintramuscular
Powder for solutionintramuscular60 mcg
Solutionintramuscular30 mcg
Injection, solutionsubcutaneous22 ug/.5mL
Injection, solutionsubcutaneous44 ug/.5mL
Kit; liquid; powderintralesional; subcutaneous
Solutionsubcutaneous132 mcg
Solutionsubcutaneous22 mcg
Solutionsubcutaneous44 mcg
Solutionsubcutaneous66 mcg
Solutionsubcutaneous8.8 mcg
Kitsubcutaneous
Prices
Unit descriptionCostUnit
Avonex 4 30 mcg/vial Kit 1 Box = 4 Vials ( 0.5ml Per Vial)3252.29USD box
Avonex Prefilled (1 Box = 1 Kit = Four 30 mcg/0.5ml Syringes) Box3252.29USD box
Avonex admin pack 30 mcg vial781.8USD vial
Rebif 22 mcg/0.5 ml syringe247.79USD syringe
Rebif 44 mcg/0.5 ml syringe247.79USD syringe
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
CountryPatent NumberApprovedExpires (estimated)
Canada13416042010-05-042027-05-04
Properties
StateLiquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.427Not Available
isoelectric point8.93Not Available
References
Synthesis Reference

Heinz-Jurgen Friesen, Sidney Pestka, “Preparation of homogeneous human fibroblast interferon.” U.S. Patent US4289689, issued December, 1968.

US4289689
General ReferencesNot Available
External Links
ATC CodesL03AB07
AHFS Codes
  • 92:00.00
PDB Entries
FDA labelDownload (63 KB)
MSDSNot Available
Interactions
Drug Interactions
Drug
TheophyllineThe metabolism of Theophylline can be decreased when combined with Interferon beta-1a.
ZidovudineThe risk or severity of adverse effects can be increased when Interferon beta-1a is combined with Zidovudine.
Food InteractionsNot Available

Targets

1. Interferon alpha/beta receptor 1

Kind: Protein

Organism: Human

Pharmacological action: yes

Actions: agonist

Components

Name UniProt ID Details
Interferon alpha/beta receptor 1 P17181 Details

References:

  1. Russell-Harde D, Wagner TC, Perez HD, Croze E: Formation of a uniquely stable type I interferon receptor complex by interferon beta is dependent upon particular interactions between interferon beta and its receptor and independent of tyrosine phosphorylation. Biochem Biophys Res Commun. 1999 Feb 16;255(2):539-44. Pubmed
  2. van Koetsveld PM, Vitale G, de Herder WW, Feelders RA, van der Wansem K, Waaijers M, van Eijck CH, Speel EJ, Croze E, van der Lely AJ, Lamberts SW, Hofland LJ: Potent inhibitory effects of type I interferons on human adrenocortical carcinoma cell growth. J Clin Endocrinol Metab. 2006 Nov;91(11):4537-43. Epub 2006 Aug 15. Pubmed
  3. Dupont SA, Goelz S, Goyal J, Green M: Mechanisms for regulation of cellular responsiveness to human IFN-beta1a. J Interferon Cytokine Res. 2002 Apr;22(4):491-501. Pubmed
  4. Runkel L, De Dios C, Karpusas M, Baker D, Li Z, Zafari M, Betzenhauser M, Muldowney C, Miller S, Redlich PN, Grossberg SE, Whitty A, Hochman PS: Mapping of IFN-beta epitopes important for receptor binding and biologic activation: comparison of results achieved using antibody-based methods and alanine substitution mutagenesis. J Interferon Cytokine Res. 2001 Nov;21(11):931-41. Pubmed

2. Interferon alpha/beta receptor 2

Kind: Protein

Organism: Human

Pharmacological action: yes

Components

Name UniProt ID Details
Interferon alpha/beta receptor 2 P48551 Details

References:

  1. van Koetsveld PM, Vitale G, de Herder WW, Feelders RA, van der Wansem K, Waaijers M, van Eijck CH, Speel EJ, Croze E, van der Lely AJ, Lamberts SW, Hofland LJ: Potent inhibitory effects of type I interferons on human adrenocortical carcinoma cell growth. J Clin Endocrinol Metab. 2006 Nov;91(11):4537-43. Epub 2006 Aug 15. Pubmed
  2. Runkel L, De Dios C, Karpusas M, Baker D, Li Z, Zafari M, Betzenhauser M, Muldowney C, Miller S, Redlich PN, Grossberg SE, Whitty A, Hochman PS: Mapping of IFN-beta epitopes important for receptor binding and biologic activation: comparison of results achieved using antibody-based methods and alanine substitution mutagenesis. J Interferon Cytokine Res. 2001 Nov;21(11):931-41. Pubmed

Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on September 23, 2015 10:01