You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameSerum albumin iodonated
Accession NumberDB00064  (BIOD00089, BTD00089)
Typebiotech
Groupsapproved
Description

A diagnostic radiopharmaceutical containing iodinated I 131 albumin for intravenous imaging. Following intravenous injection, radioiodinated albumin human is uniformly distributed throughout the intravascular pool within 10 minutes; extravascular distribution takes place more slowly (2 days). Indicated for use in determinations of total blood and plasma volumes, cardiac output, cardiac and pulmonary blood volumes and circulation times

Protein structureDb00064
Protein chemical formulaC2936H4624N786O889S41
Protein average weight66472.2000
Sequences
> Human Serum Albumin Sequence
MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPF
EDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEP
ERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLF
FAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQGLKCASLQKFGERAFKAWAV
ARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLK
ECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVGSKDVCKNYAEAKDVFLGMFLYEYAR
RHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFE
QLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDCLSVF
LNQLCVLHEKTPVSDRVTKCCTESLVNGRPCFSALEVDETYVPKEFNAETFTFHADICTL
SEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLV
Download FASTA Format
Synonyms
SynonymLanguageCode
Serum albumin precursorNot AvailableNot Available
SaltsNot Available
Brand names
NameCompany
JeanatopeNot Available
MegatopeIsoTex Diagnostics
VolumexNot Available
Brand mixturesNot Available
Categories
CAS number9048-49-1
Taxonomy
KingdomOrganic Compounds
SuperclassOrganic Acids
ClassCarboxylic Acids and Derivatives
SubclassAmino Acids, Peptides, and Analogues
Direct parentPeptides
Alternative parentsNot Available
SubstituentsNot Available
Classification descriptionNot Available
Pharmacology
IndicationFor determination of total blood and plasma volumes
PharmacodynamicsRegulates the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentrtion and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation.
Mechanism of actionSerum albumin acts as a high molecular weight, very soluble osmolyte
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
Metabolism
Route of eliminationNot Available
Half lifeNot Available
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
Manufacturers
  • Iso tex diagnostics inc
  • Bayer pharmaceuticals corp
  • Mallinckrodt medical inc
PackagersNot Available
Dosage formsNot Available
PricesNot Available
PatentsNot Available
Properties
Stateliquid
Experimental Properties
PropertyValueSource
melting point62 °CFlora, K. et al., Biophys J. 75:1084-1096 (1998)
hydrophobicity-0.395Not Available
isoelectric point5.67Not Available
References
Synthesis ReferenceNot Available
General ReferenceNot Available
External Links
ResourceLink
UniProtP02768
GenbankM12523
PharmGKBPA164752827
ATC CodesNot Available
AHFS CodesNot Available
PDB Entries
FDA labelNot Available
MSDSNot Available
Interactions
Drug InteractionsSearched, but no interactions found.
Food InteractionsNot Available

Targets

1. Apolipoprotein E

Kind: protein

Organism: Human

Pharmacological action: unknown

Components

Name UniProt ID Details
Apolipoprotein E P02649 Details

References:

  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed
  3. Wang L, Li CM, Rudolf M, Curcio CA, Peng D, Liu X, Zeng S: [Gene expression of apolipoprotein and lipids synthesis and secretion in RPE-J cells] Yan Ke Xue Bao. 2006 Dec;22(4):244-51. Pubmed
  4. Cano NJ, Saingra Y, Dupuy AM, Lorec-Penet AM, Portugal H, Lairon D, Cristol JP, Come A, Le Brun A, Atlan P, Leverve XM: Intradialytic parenteral nutrition: comparison of olive oil versus soybean oil-based lipid emulsions. Br J Nutr. 2006 Jan;95(1):152-9. Pubmed

2. Serum amyloid A-1 protein

Kind: protein

Organism: Human

Pharmacological action: unknown

Components

Name UniProt ID Details
Serum amyloid A-1 protein P0DJI8 Details

References:

  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed
  3. Danesh J, Muir J, Wong YK, Ward M, Gallimore JR, Pepys MB: Risk factors for coronary heart disease and acute-phase proteins. A population-based study. Eur Heart J. 1999 Jul;20(13):954-9. Pubmed
  4. Danesh J, Whincup P, Walker M, Lennon L, Thomson A, Appleby P, Gallimore JR, Pepys MB: Low grade inflammation and coronary heart disease: prospective study and updated meta-analyses. BMJ. 2000 Jul 22;321(7255):199-204. Pubmed
  5. Grehan S, Uhlar CM, Sim RB, Herbert J, Whitehead AS: Expression of a biologically active recombinant mouse IL-1 receptor antagonist and its use in vivo to modulate aspects of the acute phase response. J Immunol. 1997 Jul 1;159(1):369-78. Pubmed

3. Protein AMBP

Kind: protein

Organism: Human

Pharmacological action: unknown

Components

Name UniProt ID Details
Protein AMBP P02760 Details

References:

  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on September 03, 2011 17:04