Welcome to DrugBank 4.0! If you prefer, you can still go back to version 3.0.
Identification
NameInterferon beta-1b
Accession NumberDB00068  (BIOD00078, BTD00078)
Typebiotech
Groupsapproved
Description

Human interferon beta (165 residues), cysteine 17 is substituted with serine. Produced in E. coli, no carbohydrates, MW=18.5kD

Protein structureDb00068
Protein chemical formulaC908H1408N246O253S6
Protein average weight20011.0000
Sequences
>DB00068 sequence
MSYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIY
EMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSL
HLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Download FASTA Format
Synonyms
SynonymLanguageCode
Fibroblast interferonNot AvailableNot Available
IFN-betaNot AvailableNot Available
Interferon beta precursorNot AvailableNot Available
SaltsNot Available
Brand names
NameCompany
BetaseronChiron Corp
Brand mixturesNot Available
Categories
CAS number145155-23-3
Taxonomy
KingdomOrganic Compounds
SuperclassOrganic Acids
ClassCarboxylic Acids and Derivatives
SubclassAmino Acids, Peptides, and Analogues
Direct parentPeptides
Alternative parentsNot Available
SubstituentsNot Available
Classification descriptionNot Available
Pharmacology
IndicationInterferon beta-1b is a drug used for the treatment of relapsing/remitting multiple sclerosis. It has been shown to slow the advance of the disease as well as to decrease the frequency of attacks.
PharmacodynamicsInterferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin, neopterin and protein kinase R.
Mechanism of actionInterferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
AbsorptionNot Available
Volume of distribution
  • 0.25 to 2,88 L/kg
Protein bindingNot Available
Metabolism
Route of eliminationNot Available
Half lifeNot Available
Clearance
  • 9.4 – 28.9 mL/min•kg-1 [patients with diseases other than MS receiving single intravenous doses up to 2.0 mg]
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
ADMET
Predicted ADMET features
Property Value Probability
Human Intestinal Absorption Not Available Not Available
Blood Brain Barrier Not Available Not Available
Caco-2 permeable Not Available Not Available
P-glycoprotein substrate Not Available Not Available
P-glycoprotein inhibitor I Not Available Not Available
P-glycoprotein inhibitor II Not Available Not Available
Renal organic cation transporter Not Available Not Available
CYP450 2C9 substrate Not Available Not Available
CYP450 2D6 substrate Not Available Not Available
CYP450 3A4 substrate Not Available Not Available
CYP450 1A2 substrate Not Available Not Available
CYP450 2C9 substrate Not Available Not Available
CYP450 2D6 substrate Not Available Not Available
CYP450 2C19 substrate Not Available Not Available
CYP450 3A4 substrate Not Available Not Available
CYP450 inhibitory promiscuity Not Available Not Available
Ames test Not Available Not Available
Carcinogenicity Not Available Not Available
Biodegradation Not Available Not Available
Rat acute toxicity Not Available Not applicable
hERG inhibition (predictor I) Not Available Not Available
hERG inhibition (predictor II) Not Available Not Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, powder, lyophilized, for solutionSubcutaneous
Prices
Unit descriptionCostUnit
Betaseron 14 0.3 mg Solution 1 Box Contains Fourteen .3 mg Vials.3315.06USDbox
Betaseron 0.3 mg kit227.69USDkit
Extavia 0.3 mg kit196.76USDkit
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
CountryPatent NumberApprovedExpires (estimated)
Canada13408611999-12-282016-12-28
Canada13397071998-03-102015-03-10
Properties
Stateliquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.447Not Available
isoelectric point9.02Not Available
Spectra
SpectraNot Available
References
Synthesis Reference

Heinz-Jurgen Friesen, Sidney Pestka, “Preparation of homogeneous human fibroblast interferon.” U.S. Patent US4289689, issued December, 1968.

US4289689
General ReferenceNot Available
External Links
ResourceLink
UniProtP01574
GenbankV00534
PharmGKBPA450039
Drug Product Database2169649
RxListhttp://www.rxlist.com/cgi/generic/interferon_beta.htm
Drugs.comhttp://www.drugs.com/cdi/interferon-beta-1b-solution.html
WikipediaInterferon_beta-1b
ATC CodesL03AB08
AHFS CodesNot Available
PDB Entries
FDA labelshow(1.38 MB)
MSDSNot Available
Interactions
Drug Interactions
Drug
ZidovudineThe interferon increases the effect and toxicity of zidovudine
Food InteractionsNot Available

1. Interferon alpha/beta receptor 1

Kind: protein

Organism: Human

Pharmacological action: yes

Actions: agonist

Components

Name UniProt ID Details
Interferon alpha/beta receptor 1 P17181 Details

References:

  1. Russell-Harde D, Wagner TC, Perez HD, Croze E: Formation of a uniquely stable type I interferon receptor complex by interferon beta is dependent upon particular interactions between interferon beta and its receptor and independent of tyrosine phosphorylation. Biochem Biophys Res Commun. 1999 Feb 16;255(2):539-44. Pubmed
  2. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed

2. Interferon alpha/beta receptor 2

Kind: protein

Organism: Human

Pharmacological action: yes

Actions: agonist

Components

Name UniProt ID Details
Interferon alpha/beta receptor 2 P48551 Details

References:

  1. Russell-Harde D, Wagner TC, Perez HD, Croze E: Formation of a uniquely stable type I interferon receptor complex by interferon beta is dependent upon particular interactions between interferon beta and its receptor and independent of tyrosine phosphorylation. Biochem Biophys Res Commun. 1999 Feb 16;255(2):539-44. Pubmed
  2. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed

Comments
Drug created on June 13, 2005 07:24 / Updated on September 13, 2013 10:49