| Identification | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Name | Interferon beta-1b | ||||||||||||||||
| Accession Number | DB00068 (BIOD00078, BTD00078) | ||||||||||||||||
| Type | biotech | ||||||||||||||||
| Groups | approved | ||||||||||||||||
| Description | Human interferon beta (165 residues), cysteine 17 is substituted with serine. Produced in E. coli, no carbohydrates, MW=18.5kD |
||||||||||||||||
| Protein structure |
Display: 3D Structure |
||||||||||||||||
| Protein chemical formula | C908H1408N246O253S6 | ||||||||||||||||
| Protein average weight | 20011.0000 | ||||||||||||||||
| Sequences |
>DB00068 sequence MSYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIY EMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSL HLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN FASTA |
||||||||||||||||
| Synonyms |
|
||||||||||||||||
| Salts | Not Available | ||||||||||||||||
| Brand names |
|
||||||||||||||||
| Brand mixtures | Not Available | ||||||||||||||||
| Categories |
|
||||||||||||||||
| CAS number | 145155-23-3 | ||||||||||||||||
| Taxonomy | |||||||||||||||||
| Kingdom | Not Available | ||||||||||||||||
| Classes | Not Available | ||||||||||||||||
| Substructures | Not Available | ||||||||||||||||
| Pharmacology | |||||||||||||||||
| Indication | Interferon beta-1b is a drug used for the treatment of relapsing/remitting multiple sclerosis. It has been shown to slow the advance of the disease as well as to decrease the frequency of attacks. | ||||||||||||||||
| Pharmacodynamics | Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin, neopterin and protein kinase R. | ||||||||||||||||
| Mechanism of action | Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha. | ||||||||||||||||
| Absorption | Not Available | ||||||||||||||||
| Volume of distribution |
|
||||||||||||||||
| Protein binding | Not Available | ||||||||||||||||
| Metabolism |
Not Available
|
||||||||||||||||
| Route of elimination | Not Available | ||||||||||||||||
| Half life | Not Available | ||||||||||||||||
| Clearance |
|
||||||||||||||||
| Toxicity | Not Available | ||||||||||||||||
| Affected organisms |
|
||||||||||||||||
| Pathways | Not Available | ||||||||||||||||
| Pharmacoeconomics | |||||||||||||||||
| Manufacturers | Not Available | ||||||||||||||||
| Packagers | |||||||||||||||||
| Dosage forms |
|
||||||||||||||||
| Prices |
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational
purposes only.
|
||||||||||||||||
| Patents |
|
||||||||||||||||
| Properties | |||||||||||||||||
| State | liquid | ||||||||||||||||
| Experimental Properties |
|
||||||||||||||||
| References | |||||||||||||||||
| Synthesis Reference | Not Available | ||||||||||||||||
| General Reference | Not Available | ||||||||||||||||
| External Links |
|
||||||||||||||||
| ATC Codes |
|
||||||||||||||||
| AHFS Codes | Not Available | ||||||||||||||||
| PDB Entries | |||||||||||||||||
| FDA label | show (1.38 MB) | ||||||||||||||||
| MSDS | Not Available | ||||||||||||||||
| Interactions | |||||||||||||||||
| Drug Interactions |
|
||||||||||||||||
| Food Interactions | Not Available | ||||||||||||||||
| Targets |
|---|
|
1. Interferon-alpha/beta receptor alpha chain Pharmacological action: yesActions: agonist Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and IFNR alpha- and beta- subunits themselves Organism class: humanUniProt ID: P17181 ![]() Gene: IFNAR1 ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
2. Interferon-alpha/beta receptor beta chain Pharmacological action: yesActions: agonist Receptor for interferons alpha and beta. Isoform 1 and isoform 3 are directly involved in signal transduction due to their interaction with the TYR kinase, JAK1. Isoform 1 also interacts with the transcriptional factors, STAT1 and STAT2. Both forms are potent inhibitors of type I IFN activity Organism class: humanUniProt ID: P48551 ![]() Gene: IFNAR2 ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
|
| Comments |
|---|