Banner
Identification
Name Interferon beta-1b
Accession Number DB00068 (BIOD00078, BTD00078)
Type biotech
Groups approved
Description

Human interferon beta (165 residues), cysteine 17 is substituted with serine. Produced in E. coli, no carbohydrates, MW=18.5kD

Protein structure Db00068
Display: 3D Structure
Protein chemical formula C908H1408N246O253S6
Protein average weight 20011.0000
Sequences
>DB00068 sequence
MSYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIY
EMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSL
HLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

FASTA
Synonyms
  • Fibroblast interferon
  • IFN-beta
  • Interferon beta precursor
Brand names
  • Betaseron
  • Betaseron (Chiron Corp)
Brand name mixtures Not Available
Categories
  • Immunomodulatory Agents
  • Antiviral Agents
CAS number 145155-23-3
Taxonomy
Kingdom Not Available
Classes Not Available
Substructures Not Available
Pharmacology
Indication Interferon beta-1b is a drug used for the treatment of relapsing/remitting multiple sclerosis. It has been shown to slow the advance of the disease as well as to decrease the frequency of attacks.
Pharmacodynamics Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin, neopterin and protein kinase R.
Mechanism of action Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Absorption Not Available
Volume of distribution
  • 0.25 to 2,88 L/kg
Protein binding Not Available
Metabolism
Route of elimination Not Available
Half life Not Available
Clearance
  • 9.4 – 28.9 mL/min•kg-1 [patients with diseases other than MS receiving single intravenous doses up to 2.0 mg]
Toxicity Not Available
Affected organisms
  • Humans and other mammals
Pathways Not Available
Pharmacoeconomics
Manufacturers Not Available
Packagers
Dosage forms
Form Route Strength
Injection, powder, lyophilized, for solution Subcutaneous
Prices
Unit description Cost Unit
Betaseron 14 0.3 mg Solution 1 Box Contains Fourteen .3 mg Vials. 3315.06 USD box
Betaseron 0.3 mg kit 227.69 USD kit
Extavia 0.3 mg kit 196.76 USD kit
Patents
Country Patent Number Approved Expires
Canada 1340861 1999-12-28 2016-12-28
Canada 1339707 1998-03-10 2015-03-10
Properties
State liquid
Melting point Not Available
Experimental Properties
Property Value Source
hydrophobicity -0.447 PhysProp
isoelectric point 9.02 Various sources
References
Synthesis Reference Not Available
General Reference Not Available
External Links
Resource Link
UniProt P01574 Link_out
Genbank V00534 Link_out
PharmGKB PA10114 Link_out
Drug Product Database 2169649 Link_out
RxList http://www.rxlist.com/cgi/generic/interferon_beta.htm Link_out
Drugs.com http://www.drugs.com/cdi/interferon-beta-1b-solution.html Link_out
Wikipedia http://en.wikipedia.org/wiki/Interferon_beta-1b Link_out
ATC Codes
  • L03AB08
AHFS Codes Not Available
PDB Entries
FDA label show (1.4 MB)
MSDS Not Available
Interactions
Drug Interactions Not Available
Food Interactions Not Available
Targets

1. Interferon-alpha/beta receptor alpha chain

Pharmacological action: yes
Actions: agonist

Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and IFNR alpha- and beta- subunits themselves

Organism class: human
UniProt ID: P17181 Link_out
Gene: IFNAR1 Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Russell-Harde D, Wagner TC, Perez HD, Croze E: Formation of a uniquely stable type I interferon receptor complex by interferon beta is dependent upon particular interactions between interferon beta and its receptor and independent of tyrosine phosphorylation. Biochem Biophys Res Commun. 1999 Feb 16;255(2):539-44. Pubmed
  2. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed

2. Interferon-alpha/beta receptor beta chain

Pharmacological action: yes
Actions: agonist

Receptor for interferons alpha and beta. Isoform 1 and isoform 3 are directly involved in signal transduction due to their interaction with the TYR kinase, JAK1. Isoform 1 also interacts with the transcriptional factors, STAT1 and STAT2. Both forms are potent inhibitors of type I IFN activity

Organism class: human
UniProt ID: P48551 Link_out
Gene: IFNAR2 Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Russell-Harde D, Wagner TC, Perez HD, Croze E: Formation of a uniquely stable type I interferon receptor complex by interferon beta is dependent upon particular interactions between interferon beta and its receptor and independent of tyrosine phosphorylation. Biochem Biophys Res Commun. 1999 Feb 16;255(2):539-44. Pubmed
  2. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed

Comments
Drug created on June 13, 2005 07:24 / Updated on December 22, 2010 08:45

This project is supported by Genome Alberta & Genome Canada, a not-for-profit organization that is leading Canada's national genomics strategy with $600 million in funding from the federal government. This project is also supported in part by GenomeQuest, Inc., an enterprise genomic information company serving the life science community.