You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameIbritumomab tiuxetan
Accession NumberDB00078  (BTD00069, BIOD00069)
TypeBiotech
GroupsApproved
Description

Indium or yttrium conjugated murine IgG1 kappa monoclonal antibody directed against the CD20 antigen, which is found on the surface of normal and malignant B lymphocytes. Ibritumomab is produced in Chinese hamster ovary cells and is composed of two murine gamma 1 heavy chains of 445 amino acids each and two kappa light chains of 213 amino acids each.

Protein structureDb00078
Related Articles
Protein chemical formulaC6382H9830N1672O1979S54
Protein average weight143375.5 Da
Sequences
>Ibritumomab tiuxetan heavy chain
QAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGAIYPGNGDTSY
NQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARVVYYSNSYWYFDVWGTGTTVTV
SAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYT
LSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSV
FIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTL
RVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTK
KQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVER
NSYSCSVVHEGLHNHHTTKSFSR
>Ibritumomab tiuxetan light chain
QIVLSQSPAILSASPGEKVTMTCRASSSVSYMHWYQQKPGSSPKPWIYAPSNLASGVPAR
FSGSGSGTSYSLTISRVEAEDAATYYCQQWSFNPPTFGAGTKLELKRADAAPTVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFN
Download FASTA Format
Synonyms
Ibritumomab
mAb Murine (IGG1) Anti P19437 (CD20_MOUSE)
External Identifiers
  • IDEC-129
  • IDEC-Y2B8
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
ZevalinkitSpectrum Pharmaceuticals, Inc.2002-02-19Not applicableUs
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
Salts
Name/CASStructureProperties
Indium In-111 ibritumomab tiuxetan
ThumbNot applicableDBSALT001767
Yttrium y-90 ibritumomab tiuxetan
ThumbNot applicableDBSALT001768
Categories
UNII4Q52C550XK
CAS number206181-63-7
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor treatment of non-Hodgkin's lymphoma
PharmacodynamicsIbritumomab is a murine monoclonal antibody against CD20 that has been radiolabeled with yttrium-90.
Mechanism of actionThe Fab segment of the antibody targets the CD20 epitope on B-cells, allowing the radioactive yttrium to destroy the cell via production of beta particles.
Related Articles
AbsorptionNot Available
Volume of distribution

Binding observed on lymphoid cells of the bone marrow, lymph node, thymus, red and white pulp of the spleen, lymphoid follicles of the tonsil, and lymphoid nodules of other organs (e.g., large and small intestines)

Protein bindingNot Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to B cells, or by human antimurine antibody production

Route of eliminationNot Available
Half life0.8 hours (mammalian reticulocytes, in vitro)
Clearance

Approximately 7.2% of injected dose of yttrium Y 90 ibritumomab tiuxetan is excreted in urine within 7 days.

ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Kit
Prices
Unit descriptionCostUnit
Zevalin y-90 kit37800.0USD kit
Zevalin in-111 kit4200.0USD kit
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2149329 No2008-07-152013-11-12Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.359Not Available
isoelectric point7.91Not Available
References
Synthesis ReferenceNot Available
General References
  1. Link [Link]
External Links
ATC CodesNot Available
AHFS CodesNot Available
PDB Entries
FDA labelDownload (102 KB)
MSDSNot Available
Interactions
Drug Interactions
Drug
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ibritumomab.
AcenocoumarolThe risk or severity of adverse effects can be increased when Acenocoumarol is combined with Ibritumomab.
Acetylsalicylic acidThe risk or severity of adverse effects can be increased when Acetylsalicylic acid is combined with Ibritumomab.
AnagrelideThe risk or severity of adverse effects can be increased when Anagrelide is combined with Ibritumomab.
ApixabanThe risk or severity of adverse effects can be increased when Apixaban is combined with Ibritumomab.
ArgatrobanThe risk or severity of adverse effects can be increased when Argatroban is combined with Ibritumomab.
BelimumabThe risk or severity of adverse effects can be increased when Ibritumomab is combined with Belimumab.
BivalirudinThe risk or severity of adverse effects can be increased when Bivalirudin is combined with Ibritumomab.
CangrelorThe risk or severity of adverse effects can be increased when Cangrelor is combined with Ibritumomab.
CilostazolThe risk or severity of adverse effects can be increased when Cilostazol is combined with Ibritumomab.
CitalopramThe risk or severity of adverse effects can be increased when Citalopram is combined with Ibritumomab.
Citric AcidThe risk or severity of adverse effects can be increased when Citric Acid is combined with Ibritumomab.
ClopidogrelThe risk or severity of adverse effects can be increased when Clopidogrel is combined with Ibritumomab.
ClozapineThe risk or severity of adverse effects can be increased when Ibritumomab is combined with Clozapine.
Dabigatran etexilateThe risk or severity of adverse effects can be increased when Dabigatran etexilate is combined with Ibritumomab.
DalteparinThe risk or severity of adverse effects can be increased when Dalteparin is combined with Ibritumomab.
DanaparoidThe risk or severity of adverse effects can be increased when Danaparoid is combined with Ibritumomab.
DenosumabThe risk or severity of adverse effects can be increased when Denosumab is combined with Ibritumomab.
DesirudinThe risk or severity of adverse effects can be increased when Desirudin is combined with Ibritumomab.
DesvenlafaxineThe risk or severity of adverse effects can be increased when Desvenlafaxine is combined with Ibritumomab.
DiclofenacThe risk or severity of adverse effects can be increased when Diclofenac is combined with Ibritumomab.
DicoumarolThe risk or severity of adverse effects can be increased when Dicoumarol is combined with Ibritumomab.
DiflunisalThe risk or severity of adverse effects can be increased when Diflunisal is combined with Ibritumomab.
DipyridamoleThe risk or severity of adverse effects can be increased when Dipyridamole is combined with Ibritumomab.
DuloxetineThe risk or severity of adverse effects can be increased when Duloxetine is combined with Ibritumomab.
Edetic AcidThe risk or severity of adverse effects can be increased when Edetic Acid is combined with Ibritumomab.
EdoxabanThe risk or severity of adverse effects can be increased when Edoxaban is combined with Ibritumomab.
EnoxaparinThe risk or severity of adverse effects can be increased when Enoxaparin is combined with Ibritumomab.
EptifibatideThe risk or severity of adverse effects can be increased when Eptifibatide is combined with Ibritumomab.
EscitalopramThe risk or severity of adverse effects can be increased when Escitalopram is combined with Ibritumomab.
Ethyl biscoumacetateThe risk or severity of adverse effects can be increased when Ethyl biscoumacetate is combined with Ibritumomab.
EtodolacThe risk or severity of adverse effects can be increased when Etodolac is combined with Ibritumomab.
FenoprofenThe risk or severity of adverse effects can be increased when Fenoprofen is combined with Ibritumomab.
FloctafenineThe risk or severity of adverse effects can be increased when Floctafenine is combined with Ibritumomab.
FluoxetineThe risk or severity of adverse effects can be increased when Fluoxetine is combined with Ibritumomab.
FlurbiprofenThe risk or severity of adverse effects can be increased when Flurbiprofen is combined with Ibritumomab.
FluvoxamineThe risk or severity of adverse effects can be increased when Fluvoxamine is combined with Ibritumomab.
Fondaparinux sodiumThe risk or severity of adverse effects can be increased when Fondaparinux sodium is combined with Ibritumomab.
HeparinThe risk or severity of adverse effects can be increased when Heparin is combined with Ibritumomab.
IbuprofenThe risk or severity of adverse effects can be increased when Ibuprofen is combined with Ibritumomab.
IndomethacinThe risk or severity of adverse effects can be increased when Indomethacin is combined with Ibritumomab.
KetoprofenThe risk or severity of adverse effects can be increased when Ketoprofen is combined with Ibritumomab.
KetorolacThe risk or severity of adverse effects can be increased when Ketorolac is combined with Ibritumomab.
LeflunomideThe risk or severity of adverse effects can be increased when Ibritumomab is combined with Leflunomide.
LevomilnacipranThe risk or severity of adverse effects can be increased when Levomilnacipran is combined with Ibritumomab.
Mefenamic acidThe risk or severity of adverse effects can be increased when Mefenamic acid is combined with Ibritumomab.
MeloxicamThe risk or severity of adverse effects can be increased when Meloxicam is combined with Ibritumomab.
MetamizoleThe risk or severity of adverse effects can be increased when Metamizole is combined with Ibritumomab.
MilnacipranThe risk or severity of adverse effects can be increased when Milnacipran is combined with Ibritumomab.
NabumetoneThe risk or severity of adverse effects can be increased when Nabumetone is combined with Ibritumomab.
NadroparinThe risk or severity of adverse effects can be increased when Nadroparin is combined with Ibritumomab.
NaproxenThe risk or severity of adverse effects can be increased when Naproxen is combined with Ibritumomab.
NatalizumabThe risk or severity of adverse effects can be increased when Ibritumomab is combined with Natalizumab.
OxaprozinThe risk or severity of adverse effects can be increased when Oxaprozin is combined with Ibritumomab.
ParoxetineThe risk or severity of adverse effects can be increased when Paroxetine is combined with Ibritumomab.
PhenindioneThe risk or severity of adverse effects can be increased when Phenindione is combined with Ibritumomab.
PhenprocoumonThe risk or severity of adverse effects can be increased when Phenprocoumon is combined with Ibritumomab.
PimecrolimusThe risk or severity of adverse effects can be increased when Pimecrolimus is combined with Ibritumomab.
PiroxicamThe risk or severity of adverse effects can be increased when Piroxicam is combined with Ibritumomab.
PrasugrelThe risk or severity of adverse effects can be increased when Prasugrel is combined with Ibritumomab.
RivaroxabanThe risk or severity of adverse effects can be increased when Rivaroxaban is combined with Ibritumomab.
RoflumilastRoflumilast may increase the immunosuppressive activities of Ibritumomab.
SertralineThe risk or severity of adverse effects can be increased when Sertraline is combined with Ibritumomab.
Sipuleucel-TThe therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Ibritumomab.
SulindacThe risk or severity of adverse effects can be increased when Sulindac is combined with Ibritumomab.
SulodexideThe risk or severity of adverse effects can be increased when Sulodexide is combined with Ibritumomab.
TacrolimusThe risk or severity of adverse effects can be increased when Tacrolimus is combined with Ibritumomab.
Tiaprofenic acidThe risk or severity of adverse effects can be increased when Tiaprofenic acid is combined with Ibritumomab.
TicagrelorThe risk or severity of adverse effects can be increased when Ticagrelor is combined with Ibritumomab.
TiclopidineThe risk or severity of adverse effects can be increased when Ticlopidine is combined with Ibritumomab.
TinzaparinThe risk or severity of adverse effects can be increased when Tinzaparin is combined with Ibritumomab.
TirofibanThe risk or severity of adverse effects can be increased when Tirofiban is combined with Ibritumomab.
TofacitinibIbritumomab may increase the immunosuppressive activities of Tofacitinib.
TolmetinThe risk or severity of adverse effects can be increased when Tolmetin is combined with Ibritumomab.
TrastuzumabTrastuzumab may increase the neutropenic activities of Ibritumomab.
TreprostinilThe risk or severity of adverse effects can be increased when Treprostinil is combined with Ibritumomab.
VenlafaxineThe risk or severity of adverse effects can be increased when Venlafaxine is combined with Ibritumomab.
VilazodoneThe risk or severity of adverse effects can be increased when Vilazodone is combined with Ibritumomab.
VorapaxarThe risk or severity of adverse effects can be increased when Vorapaxar is combined with Ibritumomab.
VortioxetineThe risk or severity of adverse effects can be increased when Vortioxetine is combined with Ibritumomab.
WarfarinThe risk or severity of adverse effects can be increased when Warfarin is combined with Ibritumomab.
Food InteractionsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antibody
General Function:
Mhc class ii protein complex binding
Specific Function:
This protein may be involved in the regulation of B-cell activation and proliferation.
Gene Name:
MS4A1
Uniprot ID:
P11836
Molecular Weight:
33076.99 Da
References
  1. Wiseman GA, White CA, Witzig TE, Gordon LI, Emmanouilides C, Raubitschek A, Janakiraman N, Gutheil J, Schilder RJ, Spies S, Silverman DH, Grillo-Lopez AJ: Radioimmunotherapy of relapsed non-Hodgkin's lymphoma with zevalin, a 90Y-labeled anti-CD20 monoclonal antibody. Clin Cancer Res. 1999 Oct;5(10 Suppl):3281s-3286s. [PubMed:10541376 ]
  2. Goldenberg DM: The role of radiolabeled antibodies in the treatment of non-Hodgkin's lymphoma: the coming of age of radioimmunotherapy. Crit Rev Oncol Hematol. 2001 Jul-Aug;39(1-2):195-201. [PubMed:11418316 ]
  3. Dillman RO: Monoclonal antibody therapy for lymphoma: an update. Cancer Pract. 2001 Mar-Apr;9(2):71-80. [PubMed:11879282 ]
  4. Witzig TE, Gordon LI, Cabanillas F, Czuczman MS, Emmanouilides C, Joyce R, Pohlman BL, Bartlett NL, Wiseman GA, Padre N, Grillo-Lopez AJ, Multani P, White CA: Randomized controlled trial of yttrium-90-labeled ibritumomab tiuxetan radioimmunotherapy versus rituximab immunotherapy for patients with relapsed or refractory low-grade, follicular, or transformed B-cell non-Hodgkin's lymphoma. J Clin Oncol. 2002 May 15;20(10):2453-63. [PubMed:12011122 ]
  5. Witzig TE: Yttrium-90-ibritumomab tiuxetan radioimmunotherapy: a new treatment approach for B-cell non-Hodgkin's lymphoma. Drugs Today (Barc). 2004 Feb;40(2):111-9. [PubMed:15045033 ]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
  7. Goldsmith SJ: Radioimmunotherapy of lymphoma: Bexxar and Zevalin. Semin Nucl Med. 2010 Mar;40(2):122-35. doi: 10.1053/j.semnuclmed.2009.11.002. [PubMed:20113680 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Gene Name:
FCGR3B
Uniprot ID:
O75015
Molecular Weight:
26215.64 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type peptidase activity
Specific Function:
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name:
C1R
Uniprot ID:
P00736
Molecular Weight:
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QA
Uniprot ID:
P02745
Molecular Weight:
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QB
Uniprot ID:
P02746
Molecular Weight:
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QC
Uniprot ID:
P02747
Molecular Weight:
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Gene Name:
FCGR3A
Uniprot ID:
P08637
Molecular Weight:
29088.895 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type endopeptidase activity
Specific Function:
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activate C2 and C4.
Gene Name:
C1S
Uniprot ID:
P09871
Molecular Weight:
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor signaling protein activity
Specific Function:
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name:
FCGR1A
Uniprot ID:
P12314
Molecular Weight:
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
Gene Name:
FCGR2A
Uniprot ID:
P12318
Molecular Weight:
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells ...
Gene Name:
FCGR2B
Uniprot ID:
P31994
Molecular Weight:
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Transmembrane signaling receptor activity
Specific Function:
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Gene Name:
FCGR2C
Uniprot ID:
P31995
Molecular Weight:
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on April 27, 2016 10:01