| Identification | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Name | Streptokinase | ||||||||||||||||
| Accession Number | DB00086 (BIOD00028, BTD00028) | ||||||||||||||||
| Type | biotech | ||||||||||||||||
| Groups | approved | ||||||||||||||||
| Description | Streptokinase, is a sterile, purified preparation of a bacterial protein elaborated by group C (beta) -hemolytic streptococci. |
||||||||||||||||
| Protein structure |
Display: 3D Structure |
||||||||||||||||
| Protein chemical formula | C2100H3278N566O669S4 | ||||||||||||||||
| Protein average weight | 47286.7000 | ||||||||||||||||
| Sequences |
>DB00086 sequence IAGPEWLLDRPSVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPAHGGKTEQGLSPKS KPFATDSGAMSHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFAD KDGSVTLPTQPVQEFLLSGHVRVRPYKEKPIQNQAKSVDVEYTVQFTPLNPDDDFRPGLK DTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQE FTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFDRSHLKLFTIKYV DVDTNELLKSEQLLTASERNLDFRDLYDPRDKAKLLYNNLDAFGIMDYTLTGKVEDNHDD TNRIITVYMGKRPEGENASYHLAYDKDRYTEEEREVYSYLRYTGTPIPDNPNDK FASTA |
||||||||||||||||
| Synonyms |
|
||||||||||||||||
| Salts | Not Available | ||||||||||||||||
| Brand names |
|
||||||||||||||||
| Brand mixtures | Not Available | ||||||||||||||||
| Categories |
|
||||||||||||||||
| CAS number | 9002-01-1 | ||||||||||||||||
| Taxonomy | |||||||||||||||||
| Kingdom | Not Available | ||||||||||||||||
| Classes | Not Available | ||||||||||||||||
| Substructures | Not Available | ||||||||||||||||
| Pharmacology | |||||||||||||||||
| Indication | For the treatment of acute evolving transmural myocardial infarction, pulmonary embolism, deep vein thrombosis, arterial thrombosis or emolism and occlusion of arteriovenous cannulae | ||||||||||||||||
| Pharmacodynamics | Streptokinase creates an active complex which promotes the cleavage of the Arg/Val bond in plasminogen to form the proteolytic enzyme plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction. | ||||||||||||||||
| Mechanism of action | Plasminogen is an inactive molecule that becomes activated to plasmin when the Arg/Val bond is cleaved. Plasmin breaks down fibrin clots created by the blood clotting cascade. Streptokinase forms a highly specific 1:1 enzymatic complex with plasminogen which converts inactive plasminogen molecules into active plasmin. Plasmin degrades fibrin clots as well as fibrinogen and other plasma proteins. This in turn leads to the degradation of blood clots. | ||||||||||||||||
| Absorption | Not Available | ||||||||||||||||
| Volume of distribution | Not Available | ||||||||||||||||
| Protein binding | Not Available | ||||||||||||||||
| Metabolism | Not Available | ||||||||||||||||
| Route of elimination | Not Available | ||||||||||||||||
| Half life | Not Available | ||||||||||||||||
| Clearance | Not Available | ||||||||||||||||
| Toxicity | Not Available | ||||||||||||||||
| Affected organisms |
|
||||||||||||||||
| Pathways |
|
||||||||||||||||
| Pharmacoeconomics | |||||||||||||||||
| Manufacturers | Not Available | ||||||||||||||||
| Packagers | |||||||||||||||||
| Dosage forms |
|
||||||||||||||||
| Prices | Not Available | ||||||||||||||||
| Patents | Not Available | ||||||||||||||||
| Properties | |||||||||||||||||
| State | liquid | ||||||||||||||||
| Experimental Properties |
|
||||||||||||||||
| References | |||||||||||||||||
| Synthesis Reference | Not Available | ||||||||||||||||
| General Reference | Not Available | ||||||||||||||||
| External Links |
|
||||||||||||||||
| ATC Codes |
|
||||||||||||||||
| AHFS Codes |
|
||||||||||||||||
| PDB Entries | |||||||||||||||||
| FDA label | Not Available | ||||||||||||||||
| MSDS | Not Available | ||||||||||||||||
| Interactions | |||||||||||||||||
| Drug Interactions |
|
||||||||||||||||
| Food Interactions | Not Available | ||||||||||||||||
| Targets |
|---|
|
1. Plasminogen Pharmacological action: yesActions: activator Angiostatin is an angiogenesis inhibitor that blocks neovascularization and growth of experimental primary and metastatic tumors in vivo Organism class: humanUniProt ID: P00747 ![]() Gene: PLG ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
2. Proteinase-activated receptor 1 Pharmacological action: unknownActions: cleavage High affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelets activation and in vascular development Organism class: humanUniProt ID: P25116 ![]() Gene: F2R ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
|
| Enzymes |
|---|
|
Actions: inducer
Selectively hydrolyzes arachidonyl phospholipids in the sn-2 position releasing arachidonic acid. Together with its lysophospholipid activity, it is implicated in the initiation of the inflammatory response UniProt ID: P47712![]() Gene: PLA2G4A ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
|
| Comments |
|---|