You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameStreptokinase
Accession NumberDB00086  (BTD00028, BIOD00028)
TypeBiotech
GroupsApproved
Description

Streptokinase, is a sterile, purified preparation of a bacterial protein elaborated by group C (beta) -hemolytic streptococci.

Protein structureDb00086
Related Articles
Protein chemical formulaC2100H3278N566O669S4
Protein average weight47286.7 Da
Sequences
>Streptokinase Sequence DB00086
MKNYLSFGMFALLFALTFGTVNSVQAIAGPEWLLDRPSVNNSQLVVSVAGTVEGTNQDIS
LKFFEIDLTSRPAHGGKTEQGLSPKSKPFATDSGAMSHKLEKADLLKAIQEQLIANVHSN
DDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPYKEKPIQNQ
AKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGY
TIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKY
YVLKKGEKPYDPFDRSHLKLFTIKYVDVDTNELLKSEQLLTASERNLDFRDLYDPRDKAK
LLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKRPEGENASYHLAYDKDRYTEEER
EVYSYLRYTGTPIPDNPNDK
Download FASTA Format
Synonyms
Streptokinase C precursor
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Kabikinase - Pws 1500000units/vialpowder for solution1500000 unitintravenous; intracoronaryPharmacia & Upjohn Inc1995-12-312001-07-30Canada
Kabikinase - Pws 250000 Unit/vialpowder for solution250000 unitintravenous; intracoronaryPharmacia & Upjohn Inc1995-12-311999-08-12Canada
Kabikinase - Pws 750000units/vialpowder for solution750000 unitintravenous; intracoronaryPharmacia & Upjohn Inc1995-12-312001-07-30Canada
Streptasepowder for solution250000 unitintravenous; intracoronaryCsl Behring Canada Inc1994-12-312012-02-22Canada
Streptasepowder for solution1500000 unitintravenous; intracoronaryCsl Behring Canada Inc1994-12-312012-02-22Canada
Streptasepowder for solution750000 unitintravenous; intracoronaryCsl Behring Canada Inc1994-12-312012-02-22Canada
Streptase Inj 1500000 Unit/vialpowder for solution1500000 unitintravenousHoechst Canada Inc.1991-12-311996-08-29Canada
Streptase Inj 250000unit/vialpowder for solution250000 unitintravenousHoechst Canada Inc.1981-12-311996-08-29Canada
Streptase Inj 750000unit/vialpowder for solution750000 unitintravenousHoechst Canada Inc.1981-12-311996-08-29Canada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNII8X1OXL3SNU
CAS number9002-01-1
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor the treatment of acute evolving transmural myocardial infarction, pulmonary embolism, deep vein thrombosis, arterial thrombosis or emolism and occlusion of arteriovenous cannulae
PharmacodynamicsStreptokinase creates an active complex which promotes the cleavage of the Arg/Val bond in plasminogen to form the proteolytic enzyme plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction.
Mechanism of actionPlasminogen is an inactive molecule that becomes activated to plasmin when the Arg/Val bond is cleaved. Plasmin breaks down fibrin clots created by the blood clotting cascade. Streptokinase forms a highly specific 1:1 enzymatic complex with plasminogen which converts inactive plasminogen molecules into active plasmin. Plasmin degrades fibrin clots as well as fibrinogen and other plasma proteins. This in turn leads to the degradation of blood clots.
Related Articles
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half lifeNot Available
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
Pathways
PathwayCategorySMPDB ID
Streptokinase Action PathwayDrug actionSMP00282
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Powder for solutionintravenous; intracoronary1500000 unit
Powder for solutionintravenous; intracoronary250000 unit
Powder for solutionintravenous; intracoronary750000 unit
Powder for solutionintravenous1500000 unit
Powder for solutionintravenous250000 unit
Powder for solutionintravenous750000 unit
PricesNot Available
PatentsNot Available
Properties
StateLiquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.728Not Available
isoelectric point5.12Not Available
References
Synthesis Reference

Lawrence Isaac Galler, “Streptokinase derivatives with high affinity for activated platelets and methods of their production and use in thrombolytic therapy.” U.S. Patent US6087332, issued July, 1997.

US6087332
General ReferencesNot Available
External Links
ATC CodesB01AD01B06AA55
AHFS Codes
  • 20:12.20
PDB Entries
FDA labelNot Available
MSDSNot Available
Interactions
Drug Interactions
Drug
AbciximabAbciximab may increase the anticoagulant activities of Streptokinase.
AcenocoumarolStreptokinase may increase the anticoagulant activities of Acenocoumarol.
Acetylsalicylic acidAcetylsalicylic acid may increase the anticoagulant activities of Streptokinase.
Aminosalicylic AcidThe risk or severity of adverse effects can be increased when Aminosalicylic Acid is combined with Streptokinase.
AnagrelideAnagrelide may increase the anticoagulant activities of Streptokinase.
ApixabanStreptokinase may increase the anticoagulant activities of Apixaban.
AprotininThe therapeutic efficacy of Streptokinase can be decreased when used in combination with Aprotinin.
ArgatrobanStreptokinase may increase the anticoagulant activities of Argatroban.
Bismuth SubsalicylateThe risk or severity of adverse effects can be increased when Bismuth Subsalicylate is combined with Streptokinase.
BivalirudinStreptokinase may increase the anticoagulant activities of Bivalirudin.
CaffeineCaffeine may increase the anticoagulant activities of Streptokinase.
CangrelorCangrelor may increase the anticoagulant activities of Streptokinase.
CilostazolCilostazol may increase the anticoagulant activities of Streptokinase.
CitalopramCitalopram may increase the anticoagulant activities of Streptokinase.
ClopidogrelClopidogrel may increase the anticoagulant activities of Streptokinase.
Dabigatran etexilateStreptokinase may increase the anticoagulant activities of Dabigatran etexilate.
DalteparinStreptokinase may increase the anticoagulant activities of Dalteparin.
DanaparoidStreptokinase may increase the anticoagulant activities of Danaparoid.
DesirudinStreptokinase may increase the anticoagulant activities of Desirudin.
DesvenlafaxineDesvenlafaxine may increase the anticoagulant activities of Streptokinase.
DiclofenacDiclofenac may increase the anticoagulant activities of Streptokinase.
DiflunisalDiflunisal may increase the anticoagulant activities of Streptokinase.
DihydrocodeineDihydrocodeine may increase the anticoagulant activities of Streptokinase.
DipyridamoleDipyridamole may increase the anticoagulant activities of Streptokinase.
DuloxetineDuloxetine may increase the anticoagulant activities of Streptokinase.
EdoxabanStreptokinase may increase the anticoagulant activities of Edoxaban.
EnoxaparinStreptokinase may increase the anticoagulant activities of Enoxaparin.
EpoprostenolThe risk or severity of adverse effects can be increased when Streptokinase is combined with Epoprostenol.
EptifibatideEptifibatide may increase the anticoagulant activities of Streptokinase.
EscitalopramEscitalopram may increase the anticoagulant activities of Streptokinase.
EtodolacEtodolac may increase the anticoagulant activities of Streptokinase.
FenoprofenFenoprofen may increase the anticoagulant activities of Streptokinase.
FloctafenineFloctafenine may increase the anticoagulant activities of Streptokinase.
FluoxetineFluoxetine may increase the anticoagulant activities of Streptokinase.
FlurbiprofenFlurbiprofen may increase the anticoagulant activities of Streptokinase.
FluvoxamineFluvoxamine may increase the anticoagulant activities of Streptokinase.
Fondaparinux sodiumStreptokinase may increase the anticoagulant activities of Fondaparinux sodium.
HeparinStreptokinase may increase the anticoagulant activities of Heparin.
IbuprofenIbuprofen may increase the anticoagulant activities of Streptokinase.
IloprostThe risk or severity of adverse effects can be increased when Streptokinase is combined with Iloprost.
IndomethacinIndomethacin may increase the anticoagulant activities of Streptokinase.
KetoprofenKetoprofen may increase the anticoagulant activities of Streptokinase.
KetorolacKetorolac may increase the anticoagulant activities of Streptokinase.
LevomilnacipranLevomilnacipran may increase the anticoagulant activities of Streptokinase.
Magnesium salicylateThe risk or severity of adverse effects can be increased when Magnesium salicylate is combined with Streptokinase.
Mefenamic acidMefenamic acid may increase the anticoagulant activities of Streptokinase.
MeloxicamMeloxicam may increase the anticoagulant activities of Streptokinase.
MilnacipranMilnacipran may increase the anticoagulant activities of Streptokinase.
NabumetoneNabumetone may increase the anticoagulant activities of Streptokinase.
NadroparinStreptokinase may increase the anticoagulant activities of Nadroparin.
NaproxenNaproxen may increase the anticoagulant activities of Streptokinase.
OxaprozinOxaprozin may increase the anticoagulant activities of Streptokinase.
ParoxetineParoxetine may increase the anticoagulant activities of Streptokinase.
PiroxicamPiroxicam may increase the anticoagulant activities of Streptokinase.
PrasugrelPrasugrel may increase the anticoagulant activities of Streptokinase.
RivaroxabanStreptokinase may increase the anticoagulant activities of Rivaroxaban.
SalsalateThe risk or severity of adverse effects can be increased when Salsalate is combined with Streptokinase.
SertralineSertraline may increase the anticoagulant activities of Streptokinase.
SulindacSulindac may increase the anticoagulant activities of Streptokinase.
Tiaprofenic acidTiaprofenic acid may increase the anticoagulant activities of Streptokinase.
TicagrelorTicagrelor may increase the anticoagulant activities of Streptokinase.
TiclopidineTiclopidine may increase the anticoagulant activities of Streptokinase.
TinzaparinStreptokinase may increase the anticoagulant activities of Tinzaparin.
TirofibanTirofiban may increase the anticoagulant activities of Streptokinase.
TolmetinTolmetin may increase the anticoagulant activities of Streptokinase.
TreprostinilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Treprostinil.
VenlafaxineVenlafaxine may increase the anticoagulant activities of Streptokinase.
VilazodoneVilazodone may increase the anticoagulant activities of Streptokinase.
VorapaxarVorapaxar may increase the anticoagulant activities of Streptokinase.
VortioxetineVortioxetine may increase the anticoagulant activities of Streptokinase.
WarfarinStreptokinase may increase the anticoagulant activities of Warfarin.
Food InteractionsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
activator
General Function:
Serine-type peptidase activity
Specific Function:
Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1 and C5. Cleavage of fibronectin ...
Gene Name:
PLG
Uniprot ID:
P00747
Molecular Weight:
90568.415 Da
References
  1. Caballero AR, Lottenberg R, Johnston KH: Cloning, expression, sequence analysis, and characterization of streptokinases secreted by porcine and equine isolates of Streptococcus equisimilis. Infect Immun. 1999 Dec;67(12):6478-86. [PubMed:10569766 ]
  2. Alessi MC, Juhan-Vague I: [Thrombolytics and their use]. Rev Prat. 1999 Oct 1;49(15):1654-8. [PubMed:10581996 ]
  3. Chaudhary A, Vasudha S, Rajagopal K, Komath SS, Garg N, Yadav M, Mande SC, Sahni G: Function of the central domain of streptokinase in substrate plasminogen docking and processing revealed by site-directed mutagenesis. Protein Sci. 1999 Dec;8(12):2791-805. [PubMed:10631997 ]
  4. Parry MA, Zhang XC, Bode I: Molecular mechanisms of plasminogen activation: bacterial cofactors provide clues. Trends Biochem Sci. 2000 Feb;25(2):53-9. [PubMed:10664583 ]
  5. Korol'chuk VI, Makohonenko IeM, Sederkhol'm-Vil'iams SA: [Plasminogen binding with decapeptide and polypeptide fragments of streptokinase]. Ukr Biokhim Zh (1999). 1999 Sep-Oct;71(5):51-8. [PubMed:10726310 ]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
cleavage
General Function:
Thrombin receptor activity
Specific Function:
High affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelets activation and in vascular development.
Gene Name:
F2R
Uniprot ID:
P25116
Molecular Weight:
47439.83 Da
References
  1. McRedmond JP, Harriott P, Walker B, Fitzgerald DJ: Streptokinase-induced platelet activation involves antistreptokinase antibodies and cleavage of protease-activated receptor-1. Blood. 2000 Feb 15;95(4):1301-8. [PubMed:10666203 ]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
inducer
General Function:
Phospholipase a2 activity
Specific Function:
Selectively hydrolyzes arachidonyl phospholipids in the sn-2 position releasing arachidonic acid. Together with its lysophospholipid activity, it is implicated in the initiation of the inflammatory response.
Gene Name:
PLA2G4A
Uniprot ID:
P47712
Molecular Weight:
85238.2 Da
References
  1. Kawaguchi H, Iizuka K, Sano H, Yasuda H: Effect of streptokinase on prostacyclin synthesis and phospholipase activity in cultured pulmonary artery endothelial cells. Biochim Biophys Acta. 1990 Dec 10;1055(3):223-9. [PubMed:2265209 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23