Banner
Identification
Name Choriogonadotropin alfa
Accession Number DB00097 (BIOD00034, BTD00034)
Type biotech
Groups approved
Description

Recombinant human chorionic gonadotropin with 2 subunits, alpha = 92 residues, beta = 145 residues, each with N-and O-linked carbohydrate moieties linked to ASN-52 and ASN-78 (on alpha subunit) and ASN-13, ASN-30, SER-121, SER-127, SER-132 and SER-138 (on beta subunit). The primary structure of the alpha-chain of r-hCG is identical to that of the alpha-chain of hCG, FSH and LH.
Protein structure Db00097
Display: 3D Structure
Protein chemical formula C1105H1770N318O336S26
Protein average weight 25719.7000
Sequences 
>Alpha chain
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

>Beta chain
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYR
DVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS
SKAPPPSLPSPSRLPGPSDTPILPQ

FASTA
Synonyms
CG-beta
Choriogonadotropin beta chain precursor
Chorionic gonadotrophin beta subunit
Salts Not Available
Brand names
Name Company
Novarel Ferring Pharmaceuticals
Ovidrel Serono S.A.
Pregnyl Organon International
Profasi Serono S.A.
Brand mixtures Not Available
Categories
  • Fertility Agents
  • Gonadotropins
CAS number 177073-44-8
Taxonomy
Kingdom Not Available
Classes Not Available
Substructures Not Available
Pharmacology
Indication For the treatment of female infertility
Pharmacodynamics Choriogonadotropin alfa is used to treat female infertility, Choriogonadotropin alfa stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Ovidrel is an analogue of Luteinizing Hormone (LH) and binds to the LH/hCG receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of action Choriogonadotropin alfa binds to the Follicle stimulating hormone receptor which results in ovulation in the absence of sufficient endogenous Luteinizing hormone.
Absorption The mean absolute bioavailability following a single subcutaneous injection to healthy female volunteers is about 40%.
Volume of distribution
  • 5.9 ± 1.0 L
Protein binding Not Available
Metabolism Not Available
Route of elimination One-tenth of the dose is excreted in the urine.
Half life The mean terminal half-life is about 29 ± 6 hours (initial half-life is 4.5 ± 0.5 hours).
Clearance
  • 0.29 +/- 0.04 L/h [healthy down-regulated females]
Toxicity Not Available
Affected organisms
  • Humans and other mammals
Pathways Not Available
Pharmacoeconomics
Manufacturers
  • Emd serono inc
  • Ferring pharmaceuticals inc
  • App pharmaceuticals llc
  • Bel mar laboratories inc
  • Bristol myers squibb
  • Organon usa inc
Packagers
Dosage forms
Form Route Strength
Injection, solution Subcutaneous
Prices
Unit description Cost Unit
Novarel 10000 unit/10ml Solution 1 Vial = 10ml 118.55 USD vial
Novarel 10000 unit vial 113.99 USD vial
Ovidrel 250 mcg/0.5ml Injectable 0.5ml Syringe 93.22 USD syringe
Pregnyl 10000 unit Solution 60.7 USD vial
Pregnyl 10000 unit vial 57.23 USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Country Patent Number Approved Expires (estimated)
United States 6706681 2001-03-16 2021-03-16
United States 5767251 1995-06-16 2015-06-16
Properties
State solid
Experimental Properties
Property Value Source
melting point 55 °C Forastieri, H., Ingham, K.C. J. Biol. Chem. 257:7976-7981 (1982)
hydrophobicity -0.258 Not Available
isoelectric point 8.61 Not Available
References
Synthesis Reference Not Available
General Reference
  1. Kayisli UA, Selam B, Guzeloglu-Kayisli O, Demir R, Arici A: Human chorionic gonadotropin contributes to maternal immunotolerance and endometrial apoptosis by regulating Fas-Fas ligand system. J Immunol. 2003 Sep 1;171(5):2305-13. Pubmed
  2. Askling J, Erlandsson G, Kaijser M, Akre O, Ekbom A: Sickness in pregnancy and sex of child. Lancet. 1999 Dec 11;354(9195):2053. Pubmed
External Links
Resource Link
UniProt P01233 Link_out
Genbank J00117 Link_out
PharmGKB PA164783947 Link_out
Drug Product Database 2262088 Link_out
RxList http://www.rxlist.com/cgi/generic/ovidrel.htm Link_out
Drugs.com http://www.drugs.com/cdi/choriogonadotropin-alfa.html Link_out
Wikipedia http://en.wikipedia.org/wiki/Choriogonadotropin_alfa Link_out
ATC Codes
  • G03GA08
AHFS Codes Not Available
PDB Entries
FDA label show (97.1 KB)
MSDS Not Available
Interactions
Drug Interactions Not Available
Food Interactions Not Available
Targets

1. Lutropin-choriogonadotropic hormone receptor

Pharmacological action: yes

Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase

Organism class: human
UniProt ID: P22888 Link_out
Gene: LHCGR Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Bodek G, Vierre S, Rivero-Muller A, Huhtaniemi I, Ziecik AJ, Rahman NA: A novel targeted therapy of Leydig and granulosa cell tumors through the luteinizing hormone receptor using a hecate-chorionic gonadotropin beta conjugate in transgenic mice. Neoplasia. 2005 May;7(5):497-508. Pubmed
  2. Gromoll J, Wistuba J, Terwort N, Godmann M, Muller T, Simoni M: A new subclass of the luteinizing hormone/chorionic gonadotropin receptor lacking exon 10 messenger RNA in the New World monkey (Platyrrhini) lineage. Biol Reprod. 2003 Jul;69(1):75-80. Epub 2003 Feb 19. Pubmed
  3. Lin W, Bernard MP, Cao D, Myers RV, Kerrigan JE, Moyle WR: Follitropin receptors contain cryptic ligand binding sites. Mol Cell Endocrinol. 2007 Jan 2;260-262:83-92. Epub 2006 Oct 23. Pubmed

2. Follicle-stimulating hormone receptor

Pharmacological action: yes
Actions: binder

Receptor for follicle-stimulating hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase

Organism class: human
UniProt ID: P23945 Link_out
Gene: FSHR Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Jameson JL: Inherited disorders of the gonadotropin hormones. Mol Cell Endocrinol. 1996 Dec 20;125(1-2):143-9. Pubmed
  2. Lin W, Bernard MP, Cao D, Myers RV, Kerrigan JE, Moyle WR: Follitropin receptors contain cryptic ligand binding sites. Mol Cell Endocrinol. 2007 Jan 2;260-262:83-92. Epub 2006 Oct 23. Pubmed
  3. Tao YX, Segaloff DL: Chapter 5 Follicle Stimulating Hormone Receptor Mutations and Reproductive Disorders. Prog Mol Biol Transl Sci. 2009;89C:115-131. Epub 2009 Oct 7. Pubmed
  4. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed
Comments
Drug created on June 13, 2005 07:24 / Updated on September 29, 2010 14:34