You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameChorionic Gonadotropin (Recombinant)
Accession NumberDB00097  (BTD00034, BIOD00034)
TypeBiotech
GroupsApproved
Description

Recombinant human chorionic gonadotropin with 2 subunits, alpha = 92 residues, beta = 145 residues, each with N-and O-linked carbohydrate moieties linked to ASN-52 and ASN-78 (on alpha subunit) and ASN-13, ASN-30, SER-121, SER-127, SER-132 and SER-138 (on beta subunit). The primary structure of the alpha-chain of r-hCG is identical to that of the alpha-chain of hCG, FSH and LH.

Protein structureDb00097
Related Articles
Protein chemical formulaC1105H1770N318O336S26
Protein average weight25719.7 Da
Sequences
>Alpha chain
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
>Beta chain
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYR
DVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS
SKAPPPSLPSPSRLPGPSDTPILPQ
Download FASTA Format
Synonyms
CG-beta
Choriogonadotropin alpha
Choriogonadotropin beta chain precursor
Chorionic gonadotrophin beta subunit
hCG
r-HCG
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Ovidrelsolution250 mcgsubcutaneousEmd Serono A Division Of Emd Inc Canada2004-12-20Not applicableCanada
Ovidrelsolution250 mcgsubcutaneousEmd Serono A Division Of Emd Inc Canada2013-05-28Not applicableCanada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
ProfasiSerono S.A.
Brand mixturesNot Available
SaltsNot Available
Categories
UNII6413W06WR3
CAS number177073-44-8
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor the treatment of female infertility
PharmacodynamicsChoriogonadotropin alfa is used to treat female infertility, Choriogonadotropin alfa stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Ovidrel is an analogue of Luteinizing Hormone (LH) and binds to the LH/hCG receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of actionChoriogonadotropin alfa binds to the Follicle stimulating hormone receptor which results in ovulation in the absence of sufficient endogenous Luteinizing hormone.
Related Articles
AbsorptionThe mean absolute bioavailability following a single subcutaneous injection to healthy female volunteers is about 40%.
Volume of distribution
  • 5.9 ± 1.0 L
Protein bindingNot Available
MetabolismNot Available
Route of eliminationOne-tenth of the dose is excreted in the urine.
Half lifeThe mean terminal half-life is about 29 ± 6 hours (initial half-life is 4.5 ± 0.5 hours).
Clearance
  • 0.29 +/- 0.04 L/h [healthy down-regulated females]
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
Manufacturers
  • Emd serono inc
  • Ferring pharmaceuticals inc
  • App pharmaceuticals llc
  • Bel mar laboratories inc
  • Bristol myers squibb
  • Organon usa inc
Packagers
Dosage forms
FormRouteStrength
Solutionsubcutaneous250 mcg
Prices
Unit descriptionCostUnit
Novarel 10000 unit/10ml Solution 1 Vial = 10ml118.55USD vial
Novarel 10000 unit vial113.99USD vial
Ovidrel 250 mcg/0.5ml Injectable 0.5ml Syringe93.22USD syringe
Pregnyl 10000 unit Solution60.7USD vial
Pregnyl 10000 unit vial57.23USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US5767251 No1995-06-162015-06-16Us
Properties
StateSolid
Experimental Properties
PropertyValueSource
melting point55 °CForastieri, H., Ingham, K.C. J. Biol. Chem. 257:7976-7981 (1982)
hydrophobicity-0.258Not Available
isoelectric point8.61Not Available
References
Synthesis ReferenceNot Available
General References
  1. Kayisli UA, Selam B, Guzeloglu-Kayisli O, Demir R, Arici A: Human chorionic gonadotropin contributes to maternal immunotolerance and endometrial apoptosis by regulating Fas-Fas ligand system. J Immunol. 2003 Sep 1;171(5):2305-13. [PubMed:12928375 ]
  2. Askling J, Erlandsson G, Kaijser M, Akre O, Ekbom A: Sickness in pregnancy and sex of child. Lancet. 1999 Dec 11;354(9195):2053. [PubMed:10636378 ]
External Links
ATC CodesNot Available
AHFS CodesNot Available
PDB Entries
FDA labelDownload (97.1 KB)
MSDSNot Available
Interactions
Drug InteractionsNot Available
Food InteractionsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
General Function:
Luteinizing hormone receptor activity
Specific Function:
Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Gene Name:
LHCGR
Uniprot ID:
P22888
Molecular Weight:
78642.01 Da
References
  1. Bodek G, Vierre S, Rivero-Muller A, Huhtaniemi I, Ziecik AJ, Rahman NA: A novel targeted therapy of Leydig and granulosa cell tumors through the luteinizing hormone receptor using a hecate-chorionic gonadotropin beta conjugate in transgenic mice. Neoplasia. 2005 May;7(5):497-508. [PubMed:15967102 ]
  2. Gromoll J, Wistuba J, Terwort N, Godmann M, Muller T, Simoni M: A new subclass of the luteinizing hormone/chorionic gonadotropin receptor lacking exon 10 messenger RNA in the New World monkey (Platyrrhini) lineage. Biol Reprod. 2003 Jul;69(1):75-80. Epub 2003 Feb 19. [PubMed:12606382 ]
  3. Lin W, Bernard MP, Cao D, Myers RV, Kerrigan JE, Moyle WR: Follitropin receptors contain cryptic ligand binding sites. Mol Cell Endocrinol. 2007 Jan 2;260-262:83-92. Epub 2006 Oct 23. [PubMed:17059863 ]
Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
binder
General Function:
G-protein coupled peptide receptor activity
Specific Function:
Receptor for follicle-stimulating hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Induces cAMP production through the activation of PI3K-AKT and SRC-ERK1/2 signaling pathways.
Gene Name:
FSHR
Uniprot ID:
P23945
Molecular Weight:
78264.07 Da
References
  1. Jameson JL: Inherited disorders of the gonadotropin hormones. Mol Cell Endocrinol. 1996 Dec 20;125(1-2):143-9. [PubMed:9027352 ]
  2. Lin W, Bernard MP, Cao D, Myers RV, Kerrigan JE, Moyle WR: Follitropin receptors contain cryptic ligand binding sites. Mol Cell Endocrinol. 2007 Jan 2;260-262:83-92. Epub 2006 Oct 23. [PubMed:17059863 ]
  3. Tao YX, Segaloff DL: Follicle stimulating hormone receptor mutations and reproductive disorders. Prog Mol Biol Transl Sci. 2009;89:115-31. doi: 10.1016/S1877-1173(09)89005-4. Epub 2009 Oct 7. [PubMed:20374735 ]
  4. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on June 30, 2016 13:06