Welcome to DrugBank 4.0! If you prefer, you can still go back to version 3.0.
Identification
NameChoriogonadotropin alfa
Accession NumberDB00097  (BIOD00034, BTD00034)
Typebiotech
Groupsapproved
Description

Recombinant human chorionic gonadotropin with 2 subunits, alpha = 92 residues, beta = 145 residues, each with N-and O-linked carbohydrate moieties linked to ASN-52 and ASN-78 (on alpha subunit) and ASN-13, ASN-30, SER-121, SER-127, SER-132 and SER-138 (on beta subunit). The primary structure of the alpha-chain of r-hCG is identical to that of the alpha-chain of hCG, FSH and LH.

Protein structureDb00097
Protein chemical formulaC1105H1770N318O336S26
Protein average weight25719.7000
Sequences
>Alpha chain
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
>Beta chain
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYR
DVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS
SKAPPPSLPSPSRLPGPSDTPILPQ
Download FASTA Format
Synonyms
SynonymLanguageCode
CG-betaNot AvailableNot Available
Choriogonadotropin beta chain precursorNot AvailableNot Available
Chorionic gonadotrophin beta subunitNot AvailableNot Available
SaltsNot Available
Brand names
NameCompany
NovarelFerring Pharmaceuticals
OvidrelSerono S.A.
PregnylOrganon International
ProfasiSerono S.A.
Brand mixturesNot Available
CategoriesNot Available
CAS number177073-44-8
Taxonomy
KingdomOrganic Compounds
SuperclassOrganic Acids
ClassCarboxylic Acids and Derivatives
SubclassAmino Acids, Peptides, and Analogues
Direct parentPeptides
Alternative parentsNot Available
SubstituentsNot Available
Classification descriptionNot Available
Pharmacology
IndicationFor the treatment of female infertility
PharmacodynamicsChoriogonadotropin alfa is used to treat female infertility, Choriogonadotropin alfa stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Ovidrel is an analogue of Luteinizing Hormone (LH) and binds to the LH/hCG receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
Mechanism of actionChoriogonadotropin alfa binds to the Follicle stimulating hormone receptor which results in ovulation in the absence of sufficient endogenous Luteinizing hormone.
AbsorptionThe mean absolute bioavailability following a single subcutaneous injection to healthy female volunteers is about 40%.
Volume of distribution
  • 5.9 ± 1.0 L
Protein bindingNot Available
Metabolism
Route of eliminationOne-tenth of the dose is excreted in the urine.
Half lifeThe mean terminal half-life is about 29 ± 6 hours (initial half-life is 4.5 ± 0.5 hours).
Clearance
  • 0.29 +/- 0.04 L/h [healthy down-regulated females]
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
ADMET
Predicted ADMET features
Property Value Probability
Human Intestinal Absorption Not Available Not Available
Blood Brain Barrier Not Available Not Available
Caco-2 permeable Not Available Not Available
P-glycoprotein substrate Not Available Not Available
P-glycoprotein inhibitor I Not Available Not Available
P-glycoprotein inhibitor II Not Available Not Available
Renal organic cation transporter Not Available Not Available
CYP450 2C9 substrate Not Available Not Available
CYP450 2D6 substrate Not Available Not Available
CYP450 3A4 substrate Not Available Not Available
CYP450 1A2 substrate Not Available Not Available
CYP450 2C9 substrate Not Available Not Available
CYP450 2D6 substrate Not Available Not Available
CYP450 2C19 substrate Not Available Not Available
CYP450 3A4 substrate Not Available Not Available
CYP450 inhibitory promiscuity Not Available Not Available
Ames test Not Available Not Available
Carcinogenicity Not Available Not Available
Biodegradation Not Available Not Available
Rat acute toxicity Not Available Not applicable
hERG inhibition (predictor I) Not Available Not Available
hERG inhibition (predictor II) Not Available Not Available
Pharmacoeconomics
Manufacturers
  • Emd serono inc
  • Ferring pharmaceuticals inc
  • App pharmaceuticals llc
  • Bel mar laboratories inc
  • Bristol myers squibb
  • Organon usa inc
Packagers
Dosage forms
FormRouteStrength
Injection, solutionSubcutaneous
Prices
Unit descriptionCostUnit
Novarel 10000 unit/10ml Solution 1 Vial = 10ml118.55USDvial
Novarel 10000 unit vial113.99USDvial
Ovidrel 250 mcg/0.5ml Injectable 0.5ml Syringe93.22USDsyringe
Pregnyl 10000 unit Solution60.7USDvial
Pregnyl 10000 unit vial57.23USDvial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
CountryPatent NumberApprovedExpires (estimated)
United States67066812001-03-162021-03-16
United States57672511995-06-162015-06-16
Properties
Statesolid
Experimental Properties
PropertyValueSource
melting point55 °CForastieri, H., Ingham, K.C. J. Biol. Chem. 257:7976-7981 (1982)
hydrophobicity-0.258Not Available
isoelectric point8.61Not Available
Spectra
SpectraNot Available
References
Synthesis ReferenceNot Available
General Reference
  1. Kayisli UA, Selam B, Guzeloglu-Kayisli O, Demir R, Arici A: Human chorionic gonadotropin contributes to maternal immunotolerance and endometrial apoptosis by regulating Fas-Fas ligand system. J Immunol. 2003 Sep 1;171(5):2305-13. Pubmed
  2. Askling J, Erlandsson G, Kaijser M, Akre O, Ekbom A: Sickness in pregnancy and sex of child. Lancet. 1999 Dec 11;354(9195):2053. Pubmed
External Links
ResourceLink
UniProtP01233
GenbankJ00117
PharmGKBPA164783947
Drug Product Database2262088
RxListhttp://www.rxlist.com/cgi/generic/ovidrel.htm
Drugs.comhttp://www.drugs.com/cdi/choriogonadotropin-alfa.html
WikipediaChoriogonadotropin_alfa
ATC CodesG03GA08
AHFS CodesNot Available
PDB Entries
FDA labelshow(97.1 KB)
MSDSNot Available
Interactions
Drug InteractionsNot Available
Food InteractionsNot Available

1. Lutropin-choriogonadotropic hormone receptor

Kind: protein

Organism: Human

Pharmacological action: yes

Components

Name UniProt ID Details
Lutropin-choriogonadotropic hormone receptor P22888 Details

References:

  1. Bodek G, Vierre S, Rivero-Muller A, Huhtaniemi I, Ziecik AJ, Rahman NA: A novel targeted therapy of Leydig and granulosa cell tumors through the luteinizing hormone receptor using a hecate-chorionic gonadotropin beta conjugate in transgenic mice. Neoplasia. 2005 May;7(5):497-508. Pubmed
  2. Gromoll J, Wistuba J, Terwort N, Godmann M, Muller T, Simoni M: A new subclass of the luteinizing hormone/chorionic gonadotropin receptor lacking exon 10 messenger RNA in the New World monkey (Platyrrhini) lineage. Biol Reprod. 2003 Jul;69(1):75-80. Epub 2003 Feb 19. Pubmed
  3. Lin W, Bernard MP, Cao D, Myers RV, Kerrigan JE, Moyle WR: Follitropin receptors contain cryptic ligand binding sites. Mol Cell Endocrinol. 2007 Jan 2;260-262:83-92. Epub 2006 Oct 23. Pubmed

2. Follicle-stimulating hormone receptor

Kind: protein

Organism: Human

Pharmacological action: yes

Actions: binder

Components

Name UniProt ID Details
Follicle-stimulating hormone receptor P23945 Details

References:

  1. Jameson JL: Inherited disorders of the gonadotropin hormones. Mol Cell Endocrinol. 1996 Dec 20;125(1-2):143-9. Pubmed
  2. Lin W, Bernard MP, Cao D, Myers RV, Kerrigan JE, Moyle WR: Follitropin receptors contain cryptic ligand binding sites. Mol Cell Endocrinol. 2007 Jan 2;260-262:83-92. Epub 2006 Oct 23. Pubmed
  3. Tao YX, Segaloff DL: Chapter 5 Follicle Stimulating Hormone Receptor Mutations and Reproductive Disorders. Prog Mol Biol Transl Sci. 2009;89C:115-131. Epub 2009 Oct 7. Pubmed
  4. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed

Comments
Drug created on June 13, 2005 07:24 / Updated on September 29, 2010 14:34