| Version |
2.5 |
| Creation Date |
2005-06-13 13:24:05 |
| Update Date |
2009-02-19 16:03:33 |
| Primary Accession Number |
DB00522 |
| Secondary Accession Number |
|
| Name |
Bentiromide |
| Drug Type |
|
| Description |
Bentiromide is a peptide used as a screening test for exocrine pancreatic insufficiency and to monitor the adequacy of supplemental pancreatic therapy. It is given by mouth as a noninvasive test. The amount of 4-aminobenzoic acid and its metabolites excreted in the urine is taken as a measure of the chymotrypsin-secreting activity of the pancreas. Headache and gastrointestinal disturbances have been reported in patients taking bentiromide. Bentiromide is not available in the U.S. or Canada (It was withdrawn in the US in October 1996). |
| Synonyms |
- BTPABA
- Bentiromide [USAN:BAN:INN:JAN]
- Bentiromido [INN-Spanish]
- Bentiromidum [INN-Latin]
- PFD
- PFT
|
| Brand Names |
- Chymex
|
| Brand Mixtures |
Not Available |
| Chemical IUPAC Name |
4-[[2-(benzoylamino)-3-(4-hydroxyphenyl)propanoyl]amino]benzoic acid |
| Chemical Formula |
C23H20N2O5 |
| Chemical Structure |
 |
| CAS Registry Number |
37106-97-1 |
| InChI Identifier |
InChI=1/C23H20N2O5/c26-19-12-6-15(7-13-19)14-20(25-21(27)16-4-2-1-3-5-16)22(28)24-18-10-8-17(9-11-18)23(29)30/h1-13,20,26H,14H2,(H,24,28)(H,25,27)(H,29,30)/f/h24-25,29H |
| InChI Key |
SPPTWHFVYKCNNK-LMDSNWCACU |
| KEGG Drug |
D01346  |
| KEGG Compound |
Not Available |
| PubChem Compound |
2329  |
| PubChem Substance |
7848409  |
| ChEBI ID |
Not Available |
| PharmGKB ID |
PA448566  |
| HET ID |
Not Available |
| GenBank ID |
Not Available |
| Drug ID Number [DIN] |
Not Available |
| RxList Link |
Not Available |
| PDRhealth Link |
Not Available |
| Wikipedia Link |
http://en.wikipedia.org/wiki/Bentiromide  |
| FDA Label |
Not Available |
| Material Safety Data Sheet (MSDS) |
Not Available |
| Synthesis Reference |
Not Available |
| Average Molecular Weight |
404.4153 |
| Monoisotopic Molecular Weight |
404.1372 |
| State |
Solid |
| Melting Point |
241 oC |
| Experimental Water Solubility |
Not Available
Source: PhysProp
|
| Predicted Water Solubility |
4.12e-03 mg/mL
Calculated using ALOGPS
|
| Experimental LogP/Hydrophobicity |
3.3
Source: PhysProp
|
| Predicted LogP |
2.99
Calculated using ALOGPS
|
| Experimental LogS |
Not Available |
| Predicted LogS |
-4.99
Calculated using ALOGPS
|
| Experimental Caco2 Permeability |
Not Available |
| pKa/Isoelectric Point |
Not Available |
| Mass Spectrum |
Not Available
|
| MOL File |
Show | Download  |
| SDF File |
Show | Download  |
| PDB File |
Show | Download  |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Isomeric SMILES |
OC(=O)C1=CC=C(NC(=O)[C@@H](CC2=CC=C(O)C=C2)NC(=O)C2=CC=CC=C2)C=C1 |
| Canonical SMILES |
OC(=O)C1=CC=C(NC(=O)C(CC2=CC=C(O)C=C2)NC(=O)C2=CC=CC=C2)C=C1 |
| Drug Category |
- Diagnostic aids
- Indicators and Reagents
|
| ATC Codes |
|
| AHFS Codes |
Not Available |
| Indication |
Used as a screening test for exocrine pancreatic insufficiency and to monitor the adequacy of supplemental pancreatic therapy. |
| Pharmacology |
Bentiromide is a peptide used as a screening test for exocrine pancreatic insufficiency and to monitor the adequacy of supplemental pancreatic therapy. It is given by mouth as a noninvasive test. The amount of p-aminobenzoic acid and its metabolites excreted in the urine is taken as a measure of the chymotrypsin-secreting activity of the pancreas. Headache and gastrointestinal disturbances have been reported in patients taking bentiromide. Bentiromide is not available in the U.S. or Canada. |
| Mechanism of Action |
Bentiromide is a peptide that is broken down in the pancreas by lipase, protease, and amylase. By determining the output of unchanged bentiromide in the urine following oral administration, it is possible to determine the sufficiency of pancreatic activity. |
| Absorption |
Not Available |
| Toxicity |
Symptoms of overdose include shortness of breath and troubled breathing. |
| Protein Binding |
Not Available |
| Biotransformation |
Primarily hepatic. Enzymatic activity capable of hydrolyzing bentiromide has also been found in normal small intestine. |
| Half Life |
Not Available |
| Dosage Forms |
Not Available
|
| Patient Information |
Show  |
| Contraindications |
Show  |
| Interactions |
Show  |
| Drug Interactions |
Not Available
|
| Food Interactions |
Not Available
|
| Pathways |
Not Available
|
| General References |
- Drugs.com

- Wikipedia

|
| Organisms Affected |
|
| Phase 1 Metabolizing Enzymes |
- Alpha-amylase
|
| Targets |
- Pancreatic triacylglycerol lipase
|
|
Drug Target 1
[top]
|
| Target 1 ID |
754 |
| Target 1 Name |
Pancreatic triacylglycerol lipase |
| Target 1 Synonyms |
- EC 3.1.1.3
- PL
- Pancreatic lipase
- Pancreatic triacylglycerol lipase precursor
|
| Target 1 Gene Name |
PNLIP |
| Target 1 Protein Sequence |
>Pancreatic triacylglycerol lipase precursor
MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTN
ENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCIC
VDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGR
RTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH
LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGF
PCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVS
VTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWY
NNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC
|
| Target 1 Number of Residues |
472 |
| Target 1 Molecular Weight |
51157 |
| Target 1 Theoretical pI |
6.72 |
| Target 1 GO Classification |
|
Function
|
hydrolase activity
hydrolase activity, acting on ester bonds
carboxylic ester hydrolase activity
lipase activity
triacylglycerol lipase activity
catalytic activity |
|
Process
|
physiological process
metabolism
primary metabolism
lipid metabolism |
|
Component
|
| Not Available |
|
| Target 1 General Function |
Involved in triacylglycerol lipase activity |
| Target 1 Specific Function |
Not Available |
| Target 1 Pathways |
|
| Target 1 Reactions |
- triacylglycerol + H2O = diacylglycerol + a carboxylate
|
| Target 1 Pfam Domain Function |
|
| Target 1 Signals |
|
| Target 1 Transmembrane Regions |
|
| Target 1 Essentiality |
Non-Essential |
| Target 1 GenBank ID Protein |
339597  |
| Target 1 UniProtKB/Swiss-Prot ID |
P16233  |
| Target 1 UniProtKB/Swiss-Prot Entry Name |
LIPP_HUMAN  |
| Target 1 PDB ID |
1N8S  |
| Target 1 PDB File |
Show |
| Target 1 3D Structure |
|
| Target 1 Cellular Location |
|
| Target 1 Gene Sequence |
>1398 bp
ATGCTGCCACTTTGGACTCTTTCACTGCTGCTGGGAGCAGTAGCAGGAAAAGAAGTTTGC
TACGAAAGACTCGGCTGCTTCAGTGATGACTCCCCATGGTCAGGAATTACGGAAAGACCC
CTCCATATATTGCCTTGGTCTCCAAAAGATGTCAACACCCGCTTCCTCCTATATACTAAT
GAGAACCCAAACAACTTTCAAGAAGTTGCCGCAGATTCATCAAGCATCAGTGGCTCCAAT
TTCAAAACAAATAGAAAAACTCGCTTTATTATTCATGGATTCATAGACAAGGGAGAAGAA
AACTGGCTGGCCAATGTGTGCAAGAATCTGTTCAAGGTGGAAAGTGTGAACTGTATCTGT
GTGGACTGGAAAGGTGGCTCCCGAACTGGATACACACAAGCCTCGCAGAACATCAGGATC
GTGGGAGCAGAAGTGGCATATTTTGTTGAATTTCTTCAGTCGGCGTTCGGTTACTCACCT
TCCAACGTGCATGTCATTGGCCACAGCCTGGGTGCCCACGCTGCTGGGGAGGCTGGAAGG
AGAACCAATGGGACCATTGGACGCATCACAGGGTTGGACCCAGCAGAACCTTGCTTTCAG
GGCACACCTGAATTAGTCCGATTGGACCCCAGCGATGCCAAATTTGTGGATGTAATTCAC
ACGGATGGTGCCCCCATAGTCCCCAATTTGGGGTTTGGAATGAGCCAAGTCGTGGGCCAC
CTAGATTTCTTTCCAAATGGAGGAGTGGAAATGCCTGGATGTAAAAAGAACATTCTCTCT
CAGATTGTGGACATAGACGGAATCTGGGAAGGGACTCGAGACTTTGCGGCCTGTAATCAC
TTAAGAAGCTACAAATATTACACTGATAGCATCGTCAACCCTGATGGCTTTGCTGGATTC
CCCTGTGCCTCTTACAACGTCTTCACTGCAAACAAGTGTTTCCCTTGTCCAAGTGGAGGC
TGCCCACAGATGGGTCACTATGCTGATAGATATCCTGGGAAAACAAATGATGTGGGCCAG
AAATTTTATCTAGACACTGGTGATGCCAGTAATTTTGCACGTTGGAGGTATAAGGTATCT
GTCACACTGTCTGGAAAAAAGGTTACAGGACACATACTAGTTTCTTTGTTCGGAAATAAA
GGAAACTCTAAGCAGTATGAAATTTTCAAGGGCACTCTCAAACCAGATAGTACTCATTCC
AATGAATTTGACTCAGATGTGGATGTTGGGGACTTGCAGATGGTTAAATTTATTTGGTAT
AACAATGTGATCAACCCAACTTTACCTAGAGTGGGAGCATCCAAGATTATAGTGGAGACA
AATGTTGGAAAACAGTTCAACTTCTGTAGTCCAGAAACCGTCAGGGAGGAAGTTCTGCTC
ACCCTCACACCGTGTTAG
|
| Target 1 GenBank Gene ID |
|
| Target 1 GeneCard ID |
PNLIP  |
| Target 1 GenAtlas ID |
PNLIP  |
| Target 1 HGNC ID |
HGNC:9155  |
| Target 1 Chromosome Location |
10 |
| Target 1 Locus |
10q26.1 |
| Target 1 SNPs |
SNPJam Report  |
| Target 1 General References |
- Giller T, Buchwald P, Blum-Kaelin D, Hunziker W: Two novel human pancreatic lipase related proteins, hPLRP1 and hPLRP2. Differences in colipase dependence and in lipase activity. J Biol Chem. 1992 Aug 15;267(23):16509-16. [PubMed
]
- van Tilbeurgh H, Sarda L, Verger R, Cambillau C: Structure of the pancreatic lipase-procolipase complex. Nature. 1992 Sep 10;359(6391):159-62. [PubMed
]
- Winkler FK, D'Arcy A, Hunziker W: Structure of human pancreatic lipase. Nature. 1990 Feb 22;343(6260):771-4. [PubMed
]
- Lowe ME, Rosenblum JL, Strauss AW: Cloning and characterization of human pancreatic lipase cDNA. J Biol Chem. 1989 Nov 25;264(33):20042-8. [PubMed
]
- Carriere F, Thirstrup K, Boel E, Verger R, Thim L: Structure-function relationships in naturally occurring mutants of pancreatic lipase. Protein Eng. 1994 Apr;7(4):563-9. [PubMed
]
- Sims HF, Jennens ML, Lowe ME: The human pancreatic lipase-encoding gene: structure and conservation of an Alu sequence in the lipase gene family. Gene. 1993 Sep 15;131(2):281-5. [PubMed
]
- van Tilbeurgh H, Egloff MP, Martinez C, Rugani N, Verger R, Cambillau C: Interfacial activation of the lipase-procolipase complex by mixed micelles revealed by X-ray crystallography. Nature. 1993 Apr 29;362(6423):814-20. [PubMed
]
|
| Target 1 Drug References |
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
|