| Version |
2.5 |
| Creation Date |
2005-06-13 13:24:05 |
| Update Date |
2009-06-23 18:08:04 |
| Primary Accession Number |
DB00760 |
| Secondary Accession Number |
|
| Name |
Meropenem |
| Drug Type |
- Approved
- Investigational
- Small Molecule
|
| Description |
Meropenem is a broad-spectrum carbapenem antibiotic. It is active against Gram-positive and Gram-negative bacteria. Meropenem exerts its action by penetrating bacterial cells readily and interfering with the synthesis of vital cell wall components, which leads to cell death. |
| Synonyms |
- Antibiotic SM 7338
- Meropenem anhydrous
- Meropenemum [INN-Latin]
- meropenem
|
| Brand Names |
- Meronem
- Merrem
- Merrem I.V.
|
| Brand Mixtures |
Not Available |
| Chemical IUPAC Name |
(4R,5S,6S)-3-[(2S,5S)-5-(dimethylcarbamoyl)pyrrolidin-2-yl]sulfanyl-6-(1-hydroxyethyl)-4-methyl-7-oxo-1-azabicyclo[3.2.0]hept-2-ene-2-carboxylic acid |
| Chemical Formula |
C17H25N3O5S |
| Chemical Structure |
 |
| CAS Registry Number |
119478-56-7 |
| InChI Identifier |
InChI=1/C17H25N3O5S/c1-7-12-11(8(2)21)16(23)20(12)13(17(24)25)14(7)26-10-6-5-9(18-10)15(22)19(3)4/h7-12,18,21H,5-6H2,1-4H3,(H,24,25)/t7-,8-,9+,10+,11-,12-/m1/s1/f/h24H |
| InChI Key |
FSTGLKRHSQANLP-CWFNKILDDW |
| KEGG Drug |
D02222  |
| KEGG Compound |
Not Available |
| PubChem Compound |
64778  |
| PubChem Substance |
206724  |
| ChEBI ID |
Not Available |
| PharmGKB ID |
PA450383  |
| HET ID |
MER  |
| GenBank ID |
Not Available |
| Drug ID Number [DIN] |
02218496  |
| RxList Link |
http://www.rxlist.com/cgi/generic2/meropen.htm  |
| PDRhealth Link |
Not Available |
| Wikipedia Link |
http://en.wikipedia.org/wiki/Meropenem  |
| FDA Label |
|
| Material Safety Data Sheet (MSDS) |
Not Available |
| Synthesis Reference |
Not Available |
| Average Molecular Weight |
383.4630 |
| Monoisotopic Molecular Weight |
383.1515 |
| State |
Solid |
| Melting Point |
Not Available |
| Experimental Water Solubility |
Sparingly
Source: PhysProp
|
| Predicted Water Solubility |
5.64e+00 mg/mL
Calculated using ALOGPS
|
| Experimental LogP/Hydrophobicity |
-0.6
Source: PhysProp
|
| Predicted LogP |
-0.80
Calculated using ALOGPS
|
| Experimental LogS |
Not Available |
| Predicted LogS |
-1.83
Calculated using ALOGPS
|
| Experimental Caco2 Permeability |
Not Available |
| pKa/Isoelectric Point |
Not Available |
| Mass Spectrum |
Not Available
|
| MOL File |
Show | Download  |
| SDF File |
Show | Download  |
| PDB File |
Show | Download  |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Isomeric SMILES |
C[C@@H](O)[C@@H]1[C@H]2[C@@H](C)C(S[C@H]3CC[C@H](N3)C(=O)N(C)C)=C(N2C1=O)C(O)=O |
| Canonical SMILES |
CC(O)C1C2C(C)C(SC3CCC(N3)C(=O)N(C)C)=C(N2C1=O)C(O)=O |
| Drug Category |
- Anti-Bacterial Agents
- Antibacterials for Systemic Use
|
| ATC Codes |
|
| AHFS Codes |
|
| Indication |
For use as single agent therapy for the treatment of the following infections when caused by susceptible isolates of the designated microorganisms: complicated skin and skin structure infections due to Staphylococcus aureus (b-lactamase and non-b-lactamase producing, methicillin-susceptible isolates only), Streptococcus pyogenes, Streptococcus agalactiae, viridans group streptococci, Enterococcus faecalis (excluding vancomycin-resistant isolates), Pseudomonas aeruginosa, Escherichia coli, Proteus mirabilis, Bacteroides fragilis and Peptostreptococcus species; complicated appendicitis and peritonitis caused by viridans group streptococci, Escherichia coli, Klebsiella pneumoniae, Pseudomonas aeruginosa, Bacteroides fragilis, B. thetaiotaomicron, and Peptostreptococcus species. Also for use in the treatment of bacterial meningitis caused by Streptococcus pneumoniae, Haemophilus influenzae (b-lactamase and non-b-lactamase-producing isolates), and Neisseria meningitidis. |
| Pharmacology |
Meropenem is a broad-spectrum carbapenem antibiotic. It is active against Gram-positive and Gram-negative bacteria. Meropenem exerts its action by penetrating bacterial cells readily and interfering with the synthesis of vital cell wall components, which leads to cell death. |
| Mechanism of Action |
The bactericidal activity of meropenem results from the inhibition of cell wall synthesis. Meropenem readily penetrates the cell wall of most Gram-positive and Gram-negative bacteria to reach penicillin-binding- protein (PBP) targets. Its strongest affinities are toward PBPs 2, 3 and 4 of Escherichia coli and Pseudomonas aeruginosa; and PBPs 1, 2 and 4 of Staphylococcus aureus. |
| Absorption |
Not Available |
| Toxicity |
In mice and rats, large intravenous doses of meropenem (2200-4000 mg/kg) have been associated with ataxia, dyspnea, convulsions, and mortalities. |
| Protein Binding |
Approximately 2%. |
| Biotransformation |
Primarily excreted unchanged. There is one metabolite which is microbiologically inactive. |
| Half Life |
Approximately 1 hour in adults and children 2 years of age and older with normal renal function. Approximately 1.5 hours in children 3 months to 2 years of age. |
| Dosage Forms |
| Form |
Route |
| Powder, for solution |
Intravenous |
|
| Patient Information |
Show  |
| Contraindications |
Show  |
| Interactions |
Show  |
| Drug Interactions |
Not Available
|
| Food Interactions |
Not Available
|
| Pathways |
Not Available
|
| General References |
- Wikipedia

- RxList

|
| Organisms Affected |
- Enteric bacteria and other eubacteria
|
| Targets |
- Penicillin-binding protein 4
- Beta-lactamase PSE-2
|
|
Drug Target 1
[top]
|
| Target 1 ID |
819 |
| Target 1 Name |
Penicillin-binding protein 4 |
| Target 1 Synonyms |
- D-alanyl-D-alanine-endopeptidase
- DD- carboxypeptidase
- DD-peptidase
- EC 3.4.16.4
- EC 3.4.99.-
- PBP-4
- Penicillin-binding protein 4 precursor
|
| Target 1 Gene Name |
dacB |
| Target 1 Protein Sequence |
>Penicillin-binding protein 4 precursor
MRFSRFIIGLTSCIAFSVQAANVDEYITQLPAGANLALMVQKVGASAPAIDYHSQQMALP
ASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMV
ATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYS
APKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSE
PLPLAFAVQDGASYAGAILKDELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLK
IMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLS
RHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGS
LQGVYNLAGFITTASGQRMAFVQYLSGYAVEPADQRNRRIPLVRFESRLYKDIYQNN
|
| Target 1 Number of Residues |
484 |
| Target 1 Molecular Weight |
51799 |
| Target 1 Theoretical pI |
9.02 |
| Target 1 GO Classification |
|
Function
|
catalytic activity
hydrolase activity
peptidase activity
exopeptidase activity
carboxypeptidase activity
serine carboxypeptidase activity |
|
Process
|
physiological process
metabolism
macromolecule metabolism
protein metabolism
cellular protein metabolism
proteolysis |
|
Component
|
| Not Available |
|
| Target 1 General Function |
Cell wall/membrane/envelope biogenesis |
| Target 1 Specific Function |
Not involved in transpeptidation but exclusively catalyzes a DD-carboxypeptidase and DD-endopeptidase reaction |
| Target 1 Pathways |
Not Available
|
| Target 1 Reactions |
- Preferential cleavage: (Ac)2-L-Lys-D-Ala!D-Ala. Also transpeptidation of peptidyl-alanyl moieties that are N-acyl substituents of D-alanine INHIBITOR Penicillin; beta-Lactam antibiotics
|
| Target 1 Pfam Domain Function |
|
| Target 1 Signals |
|
| Target 1 Transmembrane Regions |
|
| Target 1 Essentiality |
Essential |
| Target 1 GenBank ID Protein |
41216  |
| Target 1 UniProtKB/Swiss-Prot ID |
P24228  |
| Target 1 UniProtKB/Swiss-Prot Entry Name |
PBP4_ECOLI  |
| Target 1 PDB ID |
Not Available |
| Target 1 Cellular Location |
|
| Target 1 Gene Sequence |
>1434 bp
ATGCGATTTTCCAGATTTATCATCGGATTGACCAGCTGTATAGCGTTCAGTGTTCAGGCC
GCAAATGTTGATGAGTACATTACTCAACTCCCCGCTGGTGCCAACCTTGCCCTGATGGTG
CAAAAAGTCGGCGCGTCGGCCCCCGCTATTGATTACCACAGTCAGCAGATGGCGCTGCCT
GCCAGTACCCAGAAAGTGATTACTGCGCTGGCGGCGTTGATTCAACTCGGCCCCGATTTT
CGTTTTACCACGACGCTTGAAACCAAAGGCAATGTGGAAAACGGCGTACTTAAGGGTGAC
TTAGTGGCGCGATTTGGTGCCGATCCGACGTTAAAACGTCAGGATATTCGCAATATGGTC
GCGACTTTGAAAAAATCTGGCGTCAACCAAATCGATGGCAATGTGTTGATAGATACCTCC
ATTTTCGCCAGCCACGATAAAGCCCCCGGCTGGCCATGGAATGACATGACACAATGCTTT
AGCGCTCCGCCTGCCGCCGCCATAGTTGACCGCAACTGTTTCTCCGTCTCGCTCTACAGT
GCCCCAAAGCCTGGTGATATGGCTTTTATACGCGTGGCATCTTATTACCCCGTTACGATG
TTCAGCCAGGTACGCACCCTCCCCCGTGGTTCTGCCGAAGCGCAATACTGCGAACTGGAT
GTGGTGCCAGGCGACCTGAACCGCTTTACGCTGACGGGATGCCTGCCACAACGTTCTGAG
CCGCTCCCGTTGGCTTTTGCCGTGCAGGATGGAGCCAGCTATGCCGGTGCAATTCTGAAA
GATGAGTTAAAACAGGCGGGTATCACCTGGAGCGGAACACTGCTGCGCCAGACTCAGGTT
AACGAACCTGGAACGGTAGTTGCCAGTAAACAGTCGGCCCCGCTGCACGATCTGCTTAAG
ATTATGCTGAAAAAGTCGGACAACATGATCGCCGATACGGTTTTCCGCATGATAGGCCAT
GCGCGCTTCAATGTGCCTGGAACATGGCGGGCCGGGTCGGACGCCGTGCGTCAGATCCTG
CGCCAGCAAGCCGGTGTCGATATTGGAAACACCATTATTGCCGATGGTTCAGGGCTTTCG
CGGCATAACCTGATTGCCCCCGCCACCATGATGCAGGTGCTGCAATACATTGCCCAACAC
GACAATGAACTTAACTTTATCTCCATGCTGCCGCTGGCGGGCTATGACGGCTCTTTGCAG
TACCGTGCAGGTCTGCATCAGGCGGGCGTGGATGGAAAAGTCTCAGCGAAAACCGGTTCG
TTGCAGGGGGTATATAACCTGGCGGGATTCATTACCACAGCGAGCGGGCAACGAATGGCG
TTTGTGCAATATCTTTCTGGCTATGCAGTAGAACCTGCGGATCAGCGTAATCGCCGTATT
CCGTTAGTGCGTTTTGAAAGCCGTTTGTATAAAGATATTTATCAGAACAATTAG
|
| Target 1 GenBank Gene ID |
|
| Target 1 GeneCard ID |
Not Available |
| Target 1 GenAtlas ID |
Not Available |
| Target 1 HGNC ID |
Not Available |
| Target 1 Chromosome Location |
Not Available |
| Target 1 Locus |
Not Available |
| Target 1 SNPs |
SNPJam Report  |
| Target 1 General References |
- Mottl H, Terpstra P, Keck W: Penicillin-binding protein 4 of Escherichia coli shows a novel type of primary structure among penicillin-interacting proteins. FEMS Microbiol Lett. 1991 Mar 1;62(2-3):213-20. [PubMed
]
- Korat B, Mottl H, Keck W: Penicillin-binding protein 4 of Escherichia coli: molecular cloning of the dacB gene, controlled overexpression, and alterations in murein composition. Mol Microbiol. 1991 Mar;5(3):675-84. [PubMed
]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-74. [PubMed
]
|
| Target 1 Drug References |
- Ubukata K, Shibasaki Y, Yamamoto K, Chiba N, Hasegawa K, Takeuchi Y, Sunakawa K, Inoue M, Konno M: Association of amino acid substitutions in penicillin-binding protein 3 with beta-lactam resistance in beta-lactamase-negative ampicillin-resistant Haemophilus influenzae. Antimicrob Agents Chemother. 2001 Jun;45(6):1693-9. [PubMed
]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
- Kanazawa K, Nouda H, Sunagawa M: Structure-activity relationships of carbapenem compounds to anti-Haemophilus influenzae activity and affinity for penicillin-binding proteins. Effect of 1 beta-methyl group and C-2 side chain. J Antibiot (Tokyo). 1997 Feb;50(2):162-8. [PubMed
]
|
|
Drug Target 2
[top]
|
| Target 2 ID |
2340 |
| Target 2 Name |
Beta-lactamase PSE-2 |
| Target 2 Synonyms |
- Beta lactamase OXA-10
- Beta-lactamase PSE-2 precursor
- EC 3.5.2.6
|
| Target 2 Gene Name |
pse2 |
| Target 2 Protein Sequence |
>Beta-lactamase PSE-2 precursor
MKTFAAYVIIACLSSTALAGSITENTSWNKEFSAEAVNGVFVLCKSSSKSCATNDLARAS
KEYLPASTFKIPNAIIGLETGVIKNEHQVFKWDGKPRAMKQWERDLTLRGAIQVSAVPVF
QQIAREVGEVRMQKYLKKFSYGNQNISGGIDKFWLEGQLRISAVNQVEFLESLYLNKLSA
SKENQLIVKEALVTEAAPEYLVHSKTGFSGVGTESNPGVAWWVGWVEKETEVYFFAFNMD
IDNESKLPLRKSIPTKIMESEGIIGG
|
| Target 2 Number of Residues |
270 |
| Target 2 Molecular Weight |
29507 |
| Target 2 Theoretical pI |
8.03 |
| Target 2 GO Classification |
|
Function
|
binding
drug binding
penicillin binding
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides
beta-lactamase activity |
|
Process
|
cellular physiological process
cell organization and biogenesis
external encapsulating structure organization and biogenesis
cell wall organization and biogenesis
cell wall organization and biogenesis (sensu Bacteria)
cell wall biosynthesis (sensu Bacteria)
physiological process
metabolism
cellular metabolism
drug metabolism
antibiotic metabolism
antibiotic catabolism |
|
Component
|
| Not Available |
|
| Target 2 General Function |
Defense mechanisms and antibiotic degradation |
| Target 2 Specific Function |
Hydrolyzes both carbenicillin and oxacillin |
| Target 2 Pathways |
| Name |
SMPDB Link |
KEGG Link |
| Penicillins and cephalosporins biosynthesis |
|
map00311  |
|
| Target 2 Reactions |
- a beta-lactam + H2O = a substituted beta-amino acid
|
| Target 2 Pfam Domain Function |
|
| Target 2 Signals |
|
| Target 2 Transmembrane Regions |
|
| Target 2 Essentiality |
Essential |
| Target 2 GenBank ID Protein |
1019897  |
| Target 2 UniProtKB/Swiss-Prot ID |
P14489  |
| Target 2 UniProtKB/Swiss-Prot Entry Name |
BLP2_PSEAE  |
| Target 2 PDB ID |
1K6R  |
| Target 2 PDB File |
Show |
| Target 2 3D Structure |
|
| Target 2 Cellular Location |
|
| Target 2 Gene Sequence |
>801 bp
ATGAAAACATTTGCCGCATATGTAATTATCGCGTGTCTTTCGAGTACGGCATTAGCTGGT
TCAATTACAGAAAATACGTCTTGGAACAAAGAGTTCTCTGCCGAAGCCGTCAATGGTGTC
TTCGTGCTTTGTAAAAGTAGCAGTAAATCCTGCGCTACCAATGACTTAGCTCGTGCATCA
AAGGAATATCTTCCAGCATCAACATTTAAGATCCCCAACGCAATTATCGGCCTAGAAACT
GGTGTCATAAAGAATGAGCATCAGGTTTTCAAATGGGACGGAAAGCCAAGAGCCATGAAG
CAATGGGAAAGAGACTTGACCTTAAGAGGGGCAATACAAGTTTCAGCTGTTCCCGTATTT
CAACAAATCGCCAGAGAAGTTGGCGAAGTAAGAATGCAGAAATACCTTAAAAAATTTTCC
TATGGCAACCAGAATATCAGTGGTGGCATTGACAAATTCTGGTTGGAAGGCCAGCTTAGA
ATTTCCGCAGTTAATCAAGTGGAGTTTCTAGAGTCTCTATATTTAAATAAATTGTCAGCA
TCTAAAGAAAACCAGCTAATAGTAAAAGAGGCTTTGGTAACGGAGGCGGCACCTGAATAT
CTAGTGCATTCAAAAACTGGTTTTTCTGGTGTGGGAACTGAGTCAAATCCTGGTGTCGCA
TGGTGGGTTGGGTGGGTTGAGAAGGAGACAGAGGTTTACTTTTTCGCCTTTAACATGGAT
ATAGACAACGAAAGTAAGTTGCCGCTAAGAAAATCCATTCCCACCAAAATCATGGAAAGT
GAGGGCATCATTGGTGGCTAA
|
| Target 2 GenBank Gene ID |
|
| Target 2 GeneCard ID |
Not Available |
| Target 2 GenAtlas ID |
Not Available |
| Target 2 HGNC ID |
Not Available |
| Target 2 Chromosome Location |
Not Available |
| Target 2 Locus |
Not Available |
| Target 2 SNPs |
SNPJam Report  |
| Target 2 General References |
- Maveyraud L, Golemi D, Kotra LP, Tranier S, Vakulenko S, Mobashery S, Samama JP: Insights into class D beta-lactamases are revealed by the crystal structure of the OXA10 enzyme from Pseudomonas aeruginosa. Structure. 2000 Dec 15;8(12):1289-98. [PubMed
]
- Huovinen P, Huovinen S, Jacoby GA: Sequence of PSE-2 beta-lactamase. Antimicrob Agents Chemother. 1988 Jan;32(1):134-6. [PubMed
]
|
| Target 2 Drug References |
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
|