| Version |
2.5 |
| Creation Date |
2005-06-13 13:24:05 |
| Update Date |
2009-06-23 18:07:20 |
| Primary Accession Number |
DB00828 |
| Secondary Accession Number |
|
| Name |
Fosfomycin |
| Drug Type |
|
| Description |
An antibiotic produced by Streptomyces fradiae. [PubChem] |
| Synonyms |
- Fosfocina
- Fosfomycin disodium salt
- Fosfomycin sodium
- Fosfonomycin
- Phosphomycin
- Phosphonomycin
- phosphomycin disodium salt
|
| Brand Names |
- Monurol
- Veramina
|
| Brand Mixtures |
Not Available |
| Chemical IUPAC Name |
[(2R,3S)-3-methyloxiran-2-yl]phosphonic acid |
| Chemical Formula |
C3H7O4P |
| Chemical Structure |
 |
| CAS Registry Number |
23155-02-4 |
| InChI Identifier |
InChI=1/C3H7O4P/c1-2-3(7-2)8(4,5)6/h2-3H,1H3,(H2,4,5,6)/t2-,3+/m0/s1/f/h4-5H |
| InChI Key |
YMDXZJFXQJVXBF-IAJFWYDIDS |
| KEGG Drug |
D04253  |
| KEGG Compound |
C06454  |
| PubChem Compound |
446987  |
| PubChem Substance |
8687  |
| ChEBI ID |
Not Available |
| PharmGKB ID |
PA449708  |
| HET ID |
FCN  |
| GenBank ID |
Not Available |
| Drug ID Number [DIN] |
02240335  |
| RxList Link |
http://www.rxlist.com/cgi/generic2/fosfomycin.htm  |
| PDRhealth Link |
http://www.pdrhealth.com/drug_info/rxdrugprofiles/drugs/mon1275.shtml  |
| Wikipedia Link |
http://en.wikipedia.org/wiki/Fosfomycin  |
| FDA Label |
|
| Material Safety Data Sheet (MSDS) |
|
| Synthesis Reference |
Not Available |
| Average Molecular Weight |
138.0590 |
| Monoisotopic Molecular Weight |
138.0082 |
| State |
Solid |
| Melting Point |
94 oC |
| Experimental Water Solubility |
50 mg/mL (Sodium salt)
Source: PhysProp
|
| Predicted Water Solubility |
4.69e+01 mg/mL
Calculated using ALOGPS
|
| Experimental LogP/Hydrophobicity |
-1.6
Source: PhysProp
|
| Predicted LogP |
-0.86
Calculated using ALOGPS
|
| Experimental LogS |
Not Available |
| Predicted LogS |
-0.47
Calculated using ALOGPS
|
| Experimental Caco2 Permeability |
Not Available |
| pKa/Isoelectric Point |
Not Available |
| Mass Spectrum |
Not Available
|
| MOL File |
Show | Download  |
| SDF File |
Show | Download  |
| PDB File |
Show | Download  |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Isomeric SMILES |
C[C@@H]1O[C@@H]1P(O)(O)=O |
| Canonical SMILES |
CC1OC1P(O)(O)=O |
| Drug Category |
|
| ATC Codes |
|
| AHFS Codes |
|
| Indication |
For the treatment of uncomplicated urinary tract infections (acute cystitis) in women due to susceptible strains of Escherichia coli and Enterococcus faecalis. |
| Pharmacology |
Fosfomycin is a broad spectrum antibiotic that concentrates in kidney and bladder and is used to treat uncomplicated urinary tract infections. Fosfomycin also reduces nephrotoxicity and ototoxicity of platinum-containing anti-tumor agents. |
| Mechanism of Action |
Fosfomycin is a phosphoenolpyruvate analogue produced by Streptomyces that irreversibly inhibits enolpyruvate transferase (MurA), which prevents the formation of N-acetylmuramic acid, an essential element of the peptidoglycan cell wall. |
| Absorption |
Fosfomycin tromethamine is rapidly absorbed following oral administration and converted to fosfomycin. Oral bioavailability under fasting conditions is 37%. When given with food, oral bioavailability is reduced to 30% |
| Toxicity |
LD50>5 g/kg (rats). Side effects may include diarrhea |
| Protein Binding |
0% (not bound to plasma proteins) |
| Biotransformation |
No transformation, excreted unchanged |
| Half Life |
5.7 (± 2.8) hours. The elimination half-life is 40 hours in anuric patients undergoing hemodialysis. |
| Dosage Forms |
|
| Patient Information |
Show  |
| Contraindications |
Show  |
| Interactions |
Show  |
| Drug Interactions |
Not Available
|
| Food Interactions |
- Food decreases Cmax slightly.
- Take without regard to meals.
|
| Pathways |
Not Available
|
| General References |
- Wikipedia

- RxList

- PDRhealth

|
| Organisms Affected |
- Enteric bacteria and other eubacteria
|
| Targets |
- UDP-N-acetylglucosamine 1-carboxyvinyltransferase
|
|
Drug Target 1
[top]
|
| Target 1 ID |
520 |
| Target 1 Name |
UDP-N-acetylglucosamine 1-carboxyvinyltransferase |
| Target 1 Synonyms |
- EC 2.5.1.7
- EPT
- Enoylpyruvate transferase
- UDP-N-acetylglucosamine enolpyruvyl transferase
|
| Target 1 Gene Name |
murA |
| Target 1 Protein Sequence |
>UDP-N-acetylglucosamine 1-carboxyvinyltransferase
MDKFRVQGPTKLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDVDTSMKLLSQL
GAKVERNGSVHIDARDVNVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCTIGAR
PVDLHISGLEQLGATIKLEEGYVKASVDGRLKGAHIVMDKVSVGATVTIMCAATLAEGTT
IIENAAREPEIVDTANFLITLGAKISGQGTDRIVIEGVERLGGGVYRVLPDRIETGTFLV
AAAISRGKIICRNAQPDTLDAVLAKLRDAGADIEVGEDWISLDMHGKRPKAVNVRTAPHP
AFPTDMQAQFTLLNLVAEGTGFITETVFENRFMHVPELSRMGAHAEIESNTVICHGVEKL
SGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIERVKGE
|
| Target 1 Number of Residues |
425 |
| Target 1 Molecular Weight |
44818 |
| Target 1 Theoretical pI |
6.07 |
| Target 1 GO Classification |
|
Function
|
catalytic activity
transferase activity |
|
Process
|
physiological process
metabolism
nitrogen compound metabolism
amine metabolism
amino sugar metabolism
UDP-N-acetylgalactosamine metabolism
UDP-N-acetylgalactosamine biosynthesis |
|
Component
|
| Not Available |
|
| Target 1 General Function |
Cell wall/membrane/envelope biogenesis |
| Target 1 Specific Function |
Cell wall formation. Adds enolpyruvyl to UDP-N- acetylglucosamine. Target for the antibiotic phosphomycin |
| Target 1 Pathways |
| Name |
SMPDB Link |
KEGG Link |
| Aminosugars metabolism |
|
map00530  |
|
| Target 1 Reactions |
- phosphoenolpyruvate + UDP-N-acetyl-D-glucosamine = phosphate + UDP-N-acetyl-3-O-(1-carboxyvinyl)-D-glucosamine
|
| Target 1 Pfam Domain Function |
|
| Target 1 Signals |
|
| Target 1 Transmembrane Regions |
|
| Target 1 Essentiality |
Essential |
| Target 1 GenBank ID Protein |
146902  |
| Target 1 UniProtKB/Swiss-Prot ID |
P0A749  |
| Target 1 UniProtKB/Swiss-Prot Entry Name |
MURA_ECOLI  |
| Target 1 PDB ID |
1UAE  |
| Target 1 PDB File |
Show |
| Target 1 3D Structure |
|
| Target 1 Cellular Location |
|
| Target 1 Gene Sequence |
>1260 bp
ATGGATAAATTTCGTGTTCAGGGGCCAACGAAGCTCCAGGGCGAAGTCACAATTTCCGGC
GCTAAAAATGCTGCTCTGCCTATCCTTTTTGCCGCACTACTGGCGGAAGAACCGGTAGAG
ATCCAGAACGTCCCGAAACTGAAAGACGTCGATACATCAATGAAGCTGCTAAGCCAGCTG
GGTGCGAAAGTAGAACGTAATGGTTCTGTGCATATTGATGCCCGCGACGTTAATGTATTC
TGCGCACCTTACGATCTGGTTAAAACCATGCGTGCTTCTATCTGGGCGCTGGGGCCGCTG
GTAGCGCGCTTTGGTCAGGGGCAAGTTTCACTACCTGGCGGTTGTACGATCGGTGCGCGT
CCGGTTGATCTACACATTTCTGGCCTCGAACAATTAGGCGCGACCATCAAACTGGAAGAA
GGTTACGTTAAAGCTTCCGTCGATGGTCGTTTGAAAGGTGCACATATCGTGATGGATAAA
GTCAGCGTTGGCGCAACGGTGACCATCATGTGTGCTGCAACCCTGGCGGAAGGCACCACG
ATTATTGAAAACGCAGCGCGTGAACCGGAAATCGTCGATACCGCGAACTTCCTGATTACG
CTGGGTGCGAAAATTAGCGGTCAGGGCACCGATCGTATCGTCATCGAAGGTGTGGAACGT
TTAGGCGGCGGTGTCTATCGCGTTCTGCCGGATCGTATCGAAACCGGTACTTTCCTGGTG
GCGGCGGCGATTTCTCGCGGCAAAATTATCTGCCGTAACGCGCAGCCAGATACTCTCGAC
GCCGTGCTGGCGAAACTGCGTGACGCTGGAGCGGACATCGAAGTCGGCGAAGACTGGATT
AGCCTGGATATGCATGGCAAACGTCCGAAGGCTGTTAACGTACGTACCGCGCCGCATCCG
GCATTCCCGACCGATATGCAGGCCCAGTTCACGCTGTTGAACCTGGTGGCAGAAGGGACC
GGGTTTATCACCGAAACGGTCTTTGAAAACCGCTTTATGCATGTGCCAGAGCTGAGCCGT
ATGGGCGCGCACGCCGAAATCGAAAGCAATACCGTTATTTGTCACGGTGTTGAAAAACTT
TCTGGCGCACAGGTTATGGCAACCGATCTGCGTGCATCAGCAAGCCTGGTGCTGGCTGGC
TGTATTGCGGAAGGGACGACGGTGGTTGATCGTATTTATCACATCGATCGTGGCTACGAA
CGCATTGAAGACAAACTGCGCGCTTTAGGTGCAAATATTGAGCGTGTGAAAGGCGAATAA
|
| Target 1 GenBank Gene ID |
|
| Target 1 GeneCard ID |
Not Available |
| Target 1 GenAtlas ID |
Not Available |
| Target 1 HGNC ID |
Not Available |
| Target 1 Chromosome Location |
Not Available |
| Target 1 Locus |
Not Available |
| Target 1 SNPs |
SNPJam Report  |
| Target 1 General References |
- Horii T, Kimura T, Sato K, Shibayama K, Ohta M: Emergence of fosfomycin-resistant isolates of Shiga-like toxin-producing Escherichia coli O26. Antimicrob Agents Chemother. 1999 Apr;43(4):789-93. [PubMed
]
- Marquardt JL, Siegele DA, Kolter R, Walsh CT: Cloning and sequencing of Escherichia coli murZ and purification of its product, a UDP-N-acetylglucosamine enolpyruvyl transferase. J Bacteriol. 1992 Sep;174(17):5748-52. [PubMed
]
- Skarzynski T, Mistry A, Wonacott A, Hutchinson SE, Kelly VA, Duncan K: Structure of UDP-N-acetylglucosamine enolpyruvyl transferase, an enzyme essential for the synthesis of bacterial peptidoglycan, complexed with substrate UDP-N-acetylglucosamine and the drug fosfomycin. Structure. 1996 Dec 15;4(12):1465-74. [PubMed
]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-74. [PubMed
]
- Skarzynski T, Kim DH, Lees WJ, Walsh CT, Duncan K: Stereochemical course of enzymatic enolpyruvyl transfer and catalytic conformation of the active site revealed by the crystal structure of the fluorinated analogue of the reaction tetrahedral intermediate bound to the active site of the C115A mutant of MurA. Biochemistry. 1998 Feb 24;37(8):2572-7. [PubMed
]
|
| Target 1 Drug References |
- McCoy AJ, Sandlin RC, Maurelli AT: In vitro and in vivo functional activity of Chlamydia MurA, a UDP-N-acetylglucosamine enolpyruvyl transferase involved in peptidoglycan synthesis and fosfomycin resistance. J Bacteriol. 2003 Feb;185(4):1218-28. [PubMed
]
- Eschenburg S, Priestman M, Schonbrunn E: Evidence that the fosfomycin target Cys115 in UDP-N-acetylglucosamine enolpyruvyl transferase (MurA) is essential for product release. J Biol Chem. 2005 Feb 4;280(5):3757-63. Epub 2004 Nov 5. [PubMed
]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
- Kim DH, Lees WJ, Kempsell KE, Lane WS, Duncan K, Walsh CT: Characterization of a Cys115 to Asp substitution in the Escherichia coli cell wall biosynthetic enzyme UDP-GlcNAc enolpyruvyl transferase (MurA) that confers resistance to inactivation by the antibiotic fosfomycin. Biochemistry. 1996 Apr 16;35(15):4923-8. [PubMed
]
|