| Version |
2.5 |
| Creation Date |
2005-06-13 13:24:05 |
| Update Date |
2009-02-19 16:04:08 |
| Primary Accession Number |
DB01606 |
| Secondary Accession Number |
|
| Name |
Tazobactam |
| Drug Type |
|
| Description |
Tazobactam is a antibacterial penicillin derivative which inhibits the action of bacterial beta-lactamases. |
| Synonyms |
Not Available |
| Brand Names |
Not Available |
| Brand Mixtures |
- Tazocin (Tazobactam + Piperacillin)
- Zosyn (Tazobactam + Piperacillin)
|
| Chemical IUPAC Name |
(2S,3S,5R)-3-methyl-4,4,7-trioxo-3-(triazol-1-ylmethyl)-4$l^{6}-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid |
| Chemical Formula |
C10H12N4O5S |
| Chemical Structure |
 |
| CAS Registry Number |
89786-04-9 |
| InChI Identifier |
InChI=1/C10H12N4O5S/c1-10(5-13-3-2-11-12-13)8(9(16)17)14-6(15)4-7(14)20(10,18)19/h2-3,7-8H,4-5H2,1H3,(H,16,17)/t7-,8+,10+/m1/s1/f/h16H |
| InChI Key |
LPQZKKCYTLCDGQ-OIUVGDJLDS |
| KEGG Drug |
D00660  |
| KEGG Compound |
C07771  |
| PubChem Compound |
123630  |
| PubChem Substance |
10240806  |
| ChEBI ID |
Not Available |
| PharmGKB ID |
PA451592  |
| HET ID |
Not Available |
| GenBank ID |
Not Available |
| Drug ID Number [DIN] |
02170795  |
| RxList Link |
Not Available |
| PDRhealth Link |
Not Available |
| Wikipedia Link |
http://en.wikipedia.org/wiki/Tazobactam  |
| FDA Label |
Not Available |
| Material Safety Data Sheet (MSDS) |
Not Available |
| Synthesis Reference |
Not Available |
| Average Molecular Weight |
300.2910 |
| Monoisotopic Molecular Weight |
300.0528 |
| State |
Solid |
| Melting Point |
Not Available |
| Experimental Water Solubility |
Not Available
Source: PhysProp
|
| Predicted Water Solubility |
9.59e+00 mg/mL
Calculated using ALOGPS
|
| Experimental LogP/Hydrophobicity |
Not Available
Source: PhysProp
|
| Predicted LogP |
-1.80
Calculated using ALOGPS
|
| Experimental LogS |
Not Available |
| Predicted LogS |
-1.50
Calculated using ALOGPS
|
| Experimental Caco2 Permeability |
Not Available |
| pKa/Isoelectric Point |
Not Available |
| Mass Spectrum |
Not Available
|
| MOL File |
Show | Download  |
| SDF File |
Show | Download  |
| PDB File |
Show | Download  |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
1VM1  |
| Experimental PDB File |
Show |
| Experimental PDB Structure |
|
| Isomeric SMILES |
C[C@]1(CN2C=CN=N2)[C@@H](N2[C@@H](CC2=O)S1(=O)=O)C(O)=O |
| Canonical SMILES |
CC1(CN2C=CN=N2)C(N2C(CC2=O)S1(=O)=O)C(O)=O |
| Drug Category |
|
| ATC Codes |
Not Available |
| AHFS Codes |
Not Available |
| Indication |
Used in combination with piperacillin to broaden the spectrum of piperacillin antibacterial action. |
| Pharmacology |
Tazobactam is a compound which inhibits the action of bacterial beta-lactamases. It is added to the extended spectrum beta-lactam antibiotic piperacillin. |
| Mechanism of Action |
Tazobactam broadens the spectrum of piperacillin by making it effective against organisms that express beta-lactamase and would normally degrade piperacillin. |
| Absorption |
Not Available |
| Toxicity |
Not Available |
| Protein Binding |
Not Available |
| Biotransformation |
Not Available |
| Half Life |
Not Available |
| Dosage Forms |
Not Available
|
| Patient Information |
Not Available |
| Contraindications |
Not Available |
| Interactions |
Not Available |
| Drug Interactions |
Not Available
|
| Food Interactions |
Not Available
|
| Pathways |
Not Available
|
| General References |
- Wikipedia

|
| Organisms Affected |
- Enteric bacteria and other eubacteria
|
| Targets |
- Beta-lactamase SHV-1 precursor
|
|
Drug Target 1
[top]
|
| Target 1 ID |
3687 |
| Target 1 Name |
Beta-lactamase SHV-1 precursor |
| Target 1 Synonyms |
- EC 3.5.2.6
- PIT-2
|
| Target 1 Gene Name |
bla |
| Target 1 Protein Sequence |
>Beta-lactamase SHV-1 precursor
MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE
RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA
AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA
SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG
IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
|
| Target 1 Number of Residues |
290 |
| Target 1 Molecular Weight |
31224 |
| Target 1 Theoretical pI |
8.08 |
| Target 1 GO Classification |
|
Function
|
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides
beta-lactamase activity |
|
Process
|
physiological process
metabolism
cellular metabolism
drug metabolism
antibiotic metabolism
antibiotic catabolism
beta-lactam antibiotic catabolism
response to stimulus
response to abiotic stimulus
response to chemical stimulus
response to drug
response to antibiotic |
|
Component
|
| Not Available |
|
| Target 1 General Function |
Defense mechanisms |
| Target 1 Specific Function |
A beta-lactam + H(2)O = a substituted beta- amino acid |
| Target 1 Pathways |
| Name |
SMPDB Link |
KEGG Link |
| Penicillins and cephalosporins biosynthesis |
|
map00311  |
|
| Target 1 Reactions |
- A beta-lactam + H2O = a substituted beta-amino acid
|
| Target 1 Pfam Domain Function |
|
| Target 1 Signals |
|
| Target 1 Transmembrane Regions |
|
| Target 1 Essentiality |
Non-Essential |
| Target 1 GenBank ID Protein |
5002312  |
| Target 1 UniProtKB/Swiss-Prot ID |
P0AD63  |
| Target 1 UniProtKB/Swiss-Prot Entry Name |
BLA1_ECOLI  |
| Target 1 PDB ID |
1Q2P  |
| Target 1 PDB File |
Show |
| Target 1 3D Structure |
|
| Target 1 Cellular Location |
|
| Target 1 Gene Sequence |
>861 bp
ATGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACAC
GCCAGCCCGCAGCCGCTTGAGCAAATTAAACTAAGCGAAAGCCAGCTGTCGGGCCGCGTA
GGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAA
CGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTG
GATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATCGCCAGCAGGATCTGGTGGAC
TACTCGCCGGTCAGCGAAAAACACCTTGCCGACGGCATGACGGTCGGCGAACTCTGCGCC
GCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTACTGGCCACCGTCGGCGGC
CCCGCAGGATTGACTGCCTTTTTGCGCCAGATCGGCGACAACGTCACCCGCCTTGACCGC
TGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCC
AGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAA
CGGCAGCTGCTGCAGTGGATGGTGGACGATCGGGTCGCCGGACCGTTGATCCGCTCCGTG
CTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTGGCGAGCGGGGTGCGCGCGGG
ATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGCATTGTGGTGATTTATCTGCGG
GATACCCCGGCGAGCATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTG
ATCGAGCACTGGCAACGCTAA
|
| Target 1 GenBank Gene ID |
|
| Target 1 GeneCard ID |
Not Available |
| Target 1 GenAtlas ID |
Not Available |
| Target 1 HGNC ID |
Not Available |
| Target 1 Chromosome Location |
Not Available |
| Target 1 Locus |
Not Available |
| Target 1 SNPs |
SNPJam Report  |
| Target 1 General References |
- Barthelemy M, Peduzzi J, Labia R: Complete amino acid sequence of p453-plasmid-mediated PIT-2 beta-lactamase (SHV-1). Biochem J. 1988 Apr 1;251(1):73-9. [PubMed
]
- Barthelemy M, Peduzzi J, Labia R: N-terminal amino acid sequence of PIT-2 beta-lactamase (SHV-1) J Antimicrob Chemother. 1987 Jun;19(6):839-41. [PubMed
]
|
| Target 1 Drug References |
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
|