| Version |
2.5 |
| Creation Date |
2007-08-29 20:15:57 |
| Update Date |
2009-04-16 16:48:26 |
| Primary Accession Number |
DB01620 |
| Secondary Accession Number |
Not Available |
| Name |
Pheniramine |
| Drug Type |
|
| Description |
One of the histamine H1 antagonists with little sedative action. It is used in treatment of hay fever, rhinitis, allergic dermatoses, and pruritus. [PubChem] |
| Synonyms |
- 1-Phenyl-1-(2-pyridyl)-3-dimethylaminopropane
- 2-(3-Dimethylamino-1-phenylpropyl)pyridine
- 2-(alpha-(2-Dimethylaminoethyl)benzyl)pyridine
- 2-[.alpha.-(2-Dimethylaminoethyl)benzyl]pyridine
- 2-[.alpha.-[2-(Dimethylamino)ethyl]benzyl]pyridine
- Dimethyl(3-phenyl-3-(2-pyridyl)propyl)amine
- Feniramina [inn-spanish]
- Feniramine
- Pheniraminum [inn-latin]
- Propheniramine
- Prophenpyridamine
|
| Brand Names |
- AVIL
- Inhiston
- Metron
- Pyriton
- Trimeton
- Tripoton
|
| Brand Mixtures |
- AK Vernacon Oph Solution (Pheniramine Maleate + Phenylephrine Hydrochloride)
- Calmylin Ace (Codeine Phosphate + Guaifenesin + Pheniramine Maleate)
- Citron Chaud DM Option + PWS (Dextromethorphan Hydrobromide + Pheniramine Maleate + Phenylephrine Hydrochloride + Vitamin C)
- Diopticon A Liquid (Naphazoline Hydrochloride + Pheniramine Maleate)
- Diorouge Liquid (Pheniramine Maleate + Phenylephrine Hydrochloride + Polyvinyl Alcohol)
- Dristan Decongestant Nasal Mist (Pheniramine Maleate + Phenylephrine Hydrochloride)
- Hot Lemon Cough and Colds Relief DM (Dextromethorphan Hydrobromide + Pheniramine Maleate + Phenylephrine Hydrochloride)
- Hot Lemon Extra Strength (Acetaminophen + Pheniramine Maleate + Phenylephrine Hydrochloride + Vitamin C)
- Neo Citran Colds & Flu (Acetaminophen + Pheniramine Maleate + Phenylephrine Hydrochloride)
- Neo Citran Extra Strength (Acetaminophen + Pheniramine Maleate + Phenylephrine Hydrochloride)
- Visine Advance Allergy (Naphazoline Hydrochloride + Pheniramine Maleate)
|
| Chemical IUPAC Name |
N,N-dimethyl-3-phenyl-3-pyridin-2-ylpropan-1-amine |
| Chemical Formula |
C16H20N2 |
| Chemical Structure |
 |
| CAS Registry Number |
86-21-5 |
| InChI Identifier |
InChI=1/C16H20N2/c1-18(2)13-11-15(14-8-4-3-5-9-14)16-10-6-7-12-17-16/h3-10,12,15H,11,13H2,1-2H3 |
| InChI Key |
IJHNSHDBIRRJRN-UHFFFAOYAU |
| KEGG Drug |
Not Available |
| KEGG Compound |
Not Available |
| PubChem Compound |
4761  |
| PubChem Substance |
100679  |
| ChEBI ID |
Not Available |
| PharmGKB ID |
PA450907  |
| HET ID |
Not Available |
| GenBank ID |
Not Available |
| Drug ID Number [DIN] |
Not Available |
| RxList Link |
Not Available |
| PDRhealth Link |
Not Available |
| Wikipedia Link |
http://en.wikipedia.org/wiki/Pheniramine  |
| FDA Label |
Not Available |
| Material Safety Data Sheet (MSDS) |
Not Available |
| Synthesis Reference |
Not Available |
| Average Molecular Weight |
240.3434 |
| Monoisotopic Molecular Weight |
240.1626 |
| State |
Liquid |
| Melting Point |
< 25 oC |
| Experimental Water Solubility |
Not Available
Source: PhysProp
|
| Predicted Water Solubility |
3.77e-01 mg/mL
Calculated using ALOGPS
|
| Experimental LogP/Hydrophobicity |
Not Available
Source: PhysProp
|
| Predicted LogP |
2.85
Calculated using ALOGPS
|
| Experimental LogS |
Not Available |
| Predicted LogS |
-2.80
Calculated using ALOGPS
|
| Experimental Caco2 Permeability |
Not Available |
| pKa/Isoelectric Point |
Not Available |
| Mass Spectrum |
Not Available
|
| MOL File |
Show | Download  |
| SDF File |
Show | Download  |
| PDB File |
Show | Download  |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Isomeric SMILES |
CN(C)CC[C@H](C1=CC=CC=C1)C1=CC=CC=N1 |
| Canonical SMILES |
CN(C)CCC(C1=CC=CC=C1)C1=CC=CC=N1 |
| Drug Category |
- Anti-Allergic Agents
- Antipruritic Agents
- Antipruritics
- Histamine H1 Antagonists
|
| ATC Codes |
Not Available |
| AHFS Codes |
Not Available |
| Indication |
Used to treat allergic conditions such as hay fever or urticaria. |
| Pharmacology |
Pheniramine is an antihistamine used to treat allergic conditions such as hay fever or urticaria. It is generally sold in combination with other medications, rather than as a stand-alone drug. |
| Mechanism of Action |
Antihistamines such as pheniramine appear to compete with histamine for histamine H1- receptor sites on effector cells. The antihistamines antagonize those pharmacological effects of histamine which are mediated through activation of H1- receptor sites and thereby reduce the intensity of allergic reactions and tissue injury response involving histamine release. |
| Absorption |
Not Available |
| Toxicity |
Not Available |
| Protein Binding |
Not Available |
| Biotransformation |
Hepatic hydroxylation, demethylation and glucuronidation. |
| Half Life |
Not Available |
| Dosage Forms |
| Form |
Route |
| Powder |
Oral |
| Solution |
Oral |
| Solution / drops |
Oral |
| Tablet |
Oral |
|
| Patient Information |
Show  |
| Contraindications |
Show  |
| Interactions |
Not Available |
| Drug Interactions |
Not Available
|
| Food Interactions |
Not Available
|
| Pathways |
Not Available
|
| General References |
- Wikipedia

|
| Organisms Affected |
|
| Targets |
- Histamine H1 receptor
|
|
Drug Target 1
[top]
|
| Target 1 ID |
492 |
| Target 1 Name |
Histamine H1 receptor |
| Target 1 Synonyms |
Not Available |
| Target 1 Gene Name |
HRH1 |
| Target 1 Protein Sequence |
>Histamine H1 receptor
MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHT
VGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFI
LCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKC
ETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCQHRELINRSLPSFSEIKLR
PENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKL
YCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSR
TDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI
MAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFK
RILHIRS
|
| Target 1 Number of Residues |
495 |
| Target 1 Molecular Weight |
55785 |
| Target 1 Theoretical pI |
9.58 |
| Target 1 GO Classification |
|
Function
|
amine receptor activity
histamine receptor activity
signal transducer activity
receptor activity
transmembrane receptor activity
G-protein coupled receptor activity
rhodopsin-like receptor activity |
|
Process
|
cellular process
cell communication
signal transduction
cell surface receptor linked signal transduction
G-protein coupled receptor protein signaling pathway |
|
Component
|
cell
membrane
intrinsic to membrane
integral to membrane |
|
| Target 1 General Function |
Involved in rhodopsin-like receptor activity |
| Target 1 Specific Function |
In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system |
| Target 1 Pathways |
Not Available
|
| Target 1 Reactions |
Not Available |
| Target 1 Pfam Domain Function |
|
| Target 1 Signals |
|
| Target 1 Transmembrane Regions |
- 30-49
- 64-83
- 102-123
- 146-165
- 190-210
- 419-438
- 451-470
|
| Target 1 Essentiality |
Non-Essential |
| Target 1 GenBank ID Protein |
510296  |
| Target 1 UniProtKB/Swiss-Prot ID |
P35367  |
| Target 1 UniProtKB/Swiss-Prot Entry Name |
HRH1_HUMAN  |
| Target 1 PDB ID |
Not Available |
| Target 1 Cellular Location |
- Membrane
- multi-pass membrane protein
|
| Target 1 Gene Sequence |
>1464 bp
ATGAGCCTCCCCAATTCCTCCTGCCTCTTAGAAGACAAGATGTGTGAGGGCAACAAGACC
ACTATGGCCAGCCCCCAGCTGATGCCCCTGGTGGTGGTCCTGAGCACTATCTGCTTGGTC
ACAGTAGGGCTCAACCTGCTGGTGCTGTATGCCGTACGGAGTGAGCGGAAGCTCCACACT
GTGGGGAACCTGTACATCGTCAGCCTCTCGGTGGCGGACTTGATCGTGGGTGCCGTCGTC
ATGCCTATGAACATCCTCTACCTGCTCATGTCCAAGTGGTCACTGGGCCGTCCTCTCTGC
CTCTTTTGGCTTTCCATGGACTATGTGGCCAGCACAGCGTCCATTTTCAGTGTCTTCATC
CTGTGCATTGATCGCTACCGCTCTGTCCAGCAGCCCCTCAGGTACCTTAAGTATCGTACC
AAGACCCGAGCCTCGGCCACCATTCTGGGGGCCTGGTTTCTCTCTTTTCTGTGGGTTATT
CCCATTCTAGGCTGGAATCACTTCATGCAGCAGACCTCGGTGCGCCGAGAGGACAAGTGT
GAGACAGACTTCTATGATGTCACCTGGTTCAAGGTCATGACTGCCATCATCAACTTCTAC
CTGCCCACCTTGCTCATGCTCTGGTTCTATGCCAAGATCTACAAGGCCGTACGACAACAC
TGCCAGCACCGGGAGCTCATCAATAGGTCCCTCCCTTCCTTCTCAGAAATTAAGCTGAGG
CCAGAGAACCCCAAGGGGGATGCCAAGAAACCAGGGAAGGAGTCTCCCTGGGAGGTTCTG
AAAAGGAAGCCAAAAGATGCTGGTGGTGGATCTGTCTTGAAGTCACCATCCCAAACCCCC
AAGGAGATGAAATCCCCAGTTGTCTTCAGCCAAGAGGATGATAGAGAAGTAGACAAACTC
TACTGCTTTCCACTTGATATTGTGCACATGCAGGCTGCGGCAGAGGGGAGTAGCAGGGAC
TATGTAGCCGTCAACCGGAGCCATGGCCAGCTCAAGACAGATGAGCAGGGCCTGAACACA
CATGGGGCCAGCGAGATATCAGAGGATCAGATGTTAGGTGATAGCCAATCCTTCTCTCGA
ACGGACTCAGATACCACCACAGAGACAGCACCAGGCAAAGGCAAATTGAGGAGTGGGTCT
AACACAGGCCTGGATTACATCAAGTTTACTTGGAAGAGGCTCCGCTCGCATTCAAGACAG
TATGTATCTGGGTTGCACATGAACCGCGAAAGGAAGGCCGCCAAACAGTTGGGTTTTATC
ATGGCAGCCTTCATCCTCTGCTGGATCCCTTATTTCATCTTCTTCATGGTCATTGCCTTC
TGCAAGAACTGTTGCAATGAACATTTGCACATGTTCACCATCTGGCTGGGCTACATCAAC
TCCACACTGAACCCCCTCATCTACCCCTTGTGCAATGAGAACTTCAAGAAGACATTCAAG
AGAATTCTGCATATTCGCTCCTAA
|
| Target 1 GenBank Gene ID |
|
| Target 1 GeneCard ID |
HRH1  |
| Target 1 GenAtlas ID |
HRH1  |
| Target 1 HGNC ID |
HGNC:5182  |
| Target 1 Chromosome Location |
3 |
| Target 1 Locus |
3p25 |
| Target 1 SNPs |
SNPJam Report  |
| Target 1 General References |
- Fukui H, Fujimoto K, Mizuguchi H, Sakamoto K, Horio Y, Takai S, Yamada K, Ito S: Molecular cloning of the human histamine H1 receptor gene. Biochem Biophys Res Commun. 1994 Jun 15;201(2):894-901. [PubMed
]
- De Backer MD, Gommeren W, Moereels H, Nobels G, Van Gompel P, Leysen JE, Luyten WH: Genomic cloning, heterologous expression and pharmacological characterization of a human histamine H1 receptor. Biochem Biophys Res Commun. 1993 Dec 30;197(3):1601-8. [PubMed
]
|
| Target 1 Drug References |
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
- Leurs R, Bast A, Timmerman H: High affinity, saturable [3H]mepyramine binding sites on rat liver plasma membrane do not represent histamine H1-receptors. A warning. Biochem Pharmacol. 1989 Jul 1;38(13):2175-80. [PubMed
]
- Yanni JM, Stephens DJ, Parnell DW, Spellman JM: Preclinical efficacy of emedastine, a potent, selective histamine H1 antagonist for topical ocular use. J Ocul Pharmacol. 1994 Winter;10(4):665-75. [PubMed
]
|