You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameEpoetin Zeta
Accession NumberDB08923
TypeBiotech
GroupsApproved
Description

The active substance in Epoetin zeta is a recombinant human erythropoietin (rhEPO) of identical primary structure produced in Chinese Hamster Ovary (CHO) cells. The molecular weight of the glycosylated protein is 30.6 kDa according to the Ph. Eur. monograph, 40% of which are carbohydrate structures. The oligosaccharide chains are subject to posttranslational modifications and display heterogeneity to a certain extent. Epoetin zeta is also identical to Epoetin alfa in terms of its amino acid sequence.

Protein structureDb08923
Related Articles
Protein chemical formulaC809H1301N229O240S5
Protein average weight18200.0 Da
Sequences
>DB08923 sequence
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA
VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS
PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Download FASTA Format
Synonyms
1-165-Erythropoietin (human clone B03XA01) glycoform zeta
Epoetin zeta
Epoetina dseta
Epoétine zêta
Epoetinum zeta
External Identifiers
  • SB309
Approved Prescription ProductsNot Available
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
Epobel®Nobel Ilac Pazarlama ve Sanayii Ltd. STI., Turkey
Eqralys®Hemofarm AD
Retacrit®Hospira, Inc.
Silapo®Cell Pharm GmbH
Silapo® Stada Arzneimittel AG
Brand mixturesNot Available
SaltsNot Available
CategoriesNot Available
UNIINot Available
CAS number604802-70-2
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor use in the treatment of symptomatic anaemia associated with chronic renal failure (CRF) in adult and paediatric patients. Also for use in the treatment of anaemia and reduction of transfusion requirements in adult patients receiving chemotherapy for solid tumours, malignant lymphoma or multiple myeloma, and at risk of transfusion as assessed by the patient's general status (e.g. cardiovascular status, pre-existing anaemia at the start of chemotherapy). Also for used to increase the yield of autologous blood from patients in a predonation program. When administered subcutaneously, Epoetin Zeta is equivalent to Epoetin Alfa in terms of clinical effectiveness.
PharmacodynamicsUsed in the treatment of anemia. Involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of actionBinding of erythropoietin to the erythropoietin receptor leads to receptor dimerization, which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Related Articles
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half lifeToxicokinetic results from rats in a 13 week toxicity study after a single subcutaneous dose: 7.37 hours (+/- 0.70) with 500 IU/kg [test 1] 8.63 hours (+/- 2.78) with 2500 IU/kg [test 2] 8.76 hours (+/- 1.46) with 2500 IU/kg [reference dose]
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
ManufacturersNot Available
PackagersNot Available
Dosage formsNot Available
PricesNot Available
PatentsNot Available
Properties
StateLiquid
Experimental PropertiesNot Available
References
Synthesis ReferenceNot Available
General References
  1. Wizemann V, Rutkowski B, Baldamus C, Scigalla P, Koytchev R: Comparison of the therapeutic effects of epoetin zeta to epoetin alfa in the maintenance phase of renal anaemia treatment. Curr Med Res Opin. 2008 Mar;24(3):625-37. doi: 10.1185/030079908X273264. [PubMed:18208642 ]
  2. Krivoshiev S, Wizemann V, Czekalski S, Schiller A, Pljesa S, Wolf-Pflugmann M, Siebert-Weigel M, Koytchev R, Bronn A: Therapeutic equivalence of epoetin zeta and alfa, administered subcutaneously, for maintenance treatment of renal anemia. Adv Ther. 2010 Feb;27(2):105-17. doi: 10.1007/s12325-010-0012-y. Epub 2010 Mar 30. [PubMed:20369312 ]
  3. Brinks V, Hawe A, Basmeleh AH, Joachin-Rodriguez L, Haselberg R, Somsen GW, Jiskoot W, Schellekens H: Quality of original and biosimilar epoetin products. Pharm Res. 2011 Feb;28(2):386-93. doi: 10.1007/s11095-010-0288-2. Epub 2010 Oct 1. [PubMed:20886265 ]
  4. Link [Link]
External Links
ATC CodesNot Available
AHFS CodesNot Available
PDB EntriesNot Available
FDA labelNot Available
MSDSNot Available
Interactions
Drug InteractionsNo interactions found.
Food InteractionsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Identical protein binding
Specific Function:
Receptor for erythropoietin. Mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, can also activate STAT1 and STAT3. May also activate the LYN tyrosine kinase.Isoform EPOR-T acts as a dominant-negative receptor of EPOR-mediated signaling.
Gene Name:
EPOR
Uniprot ID:
P19235
Molecular Weight:
55064.725 Da
References
  1. Barosi G, Bosi A, Abbracchio MP, Danesi R, Genazzani A, Corradini P, Pane F, Tura S: Key concepts and critical issues on epoetin and filgrastim biosimilars. A position paper from the Italian Society of Hematology, Italian Society of Experimental Hematology, and Italian Group for Bone Marrow Transplantation. Haematologica. 2011 Jul;96(7):937-42. doi: 10.3324/haematol.2011.041210. [PubMed:21719882 ]
  2. Wizemann V, Rutkowski B, Baldamus C, Scigalla P, Koytchev R: Comparison of the therapeutic effects of epoetin zeta to epoetin alfa in the maintenance phase of renal anaemia treatment. Curr Med Res Opin. 2008 Mar;24(3):625-37. doi: 10.1185/030079908X273264. [PubMed:18208642 ]
Comments
comments powered by Disqus
Drug created on October 03, 2013 09:32 / Updated on August 17, 2016 12:24