| ID |
1102 |
| Name |
Low affinity immunoglobulin gamma Fc region receptor III-B |
| Synonyms |
- IgG Fc receptor III-1
- Fc-gamma RIII-beta
- Fc-gamma RIIIb
- FcRIIIb
- Fc-gamma RIII
- FcRIII
- FcR-10
- CD16b antigen
- Low affinity immunoglobulin gamma Fc region receptor III-B precursor
|
| Gene Name |
FCGR3B |
| Protein Sequence |
>Low affinity immunoglobulin gamma Fc region receptor III-B precursor
MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQW
FHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKE
EDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKN
VSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI
|
| Number of Residues |
233 |
| Molecular Weight |
26216 |
| Theoretical pI |
6.71 |
| GO Classification |
Not Available |
| General Function |
Not Available |
| Specific Function |
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils |
| Pathways |
Not Available |
| Reactions |
Not Available |
| Pfam Domain Function |
|
| Signals |
1-16 |
| Transmembrane Regions |
None |
| Essentiality |
Non-Essential |
| GenBank Protein ID |
31322  |
| UniProtKB ID |
O75015 |
| UniProtKB Entry Name |
FCG3B_HUMAN |
| PDB ID |
1E4K |
| PDB File |
show |
| 3D Structure |
View 3D Structure |
| Cellular Location |
Cell membrane; lipid-anchor; GPI-anchor. Secreted protein. Note=Secreted after cleavage |
| Gene Sequence |
>702 bp
ATGTGGCAGCTGCTCCTCCCAACTGCTCTGCTACTTCTAGTTTCAGCTGGCATGCGGACT
GAAGATCTCCCAAAGGCTGTGGTGTTCCTGGAGCCTCAATGGTACAGCGTGCTTGAGAAG
GACAGTGTGACTCTGAAGTGCCAGGGAGCCTACTCCCCTGAGGACAATTCCACACAGTGG
TTTCACAATGAGAGCCTCATCTCAAGCCAGGCCTCGAGCTACTTCATTGACGCTGCCACA
GTCAACGACAGTGGAGAGTACAGGTGCCAGACAAACCTCTCCACCCTCAGTGACCCGGTG
CAGCTAGAAGTCCATATCGGCTGGCTGTTGCTCCAGGCCCCTCGGTGGGTGTTCAAGGAG
GAAGACCCTATTCACCTGAGGTGTCACAGCTGGAAGAACACTGCTCTGCATAAGGTCACA
TATTTACAGAATGGCAAAGACAGGAAGTATTTTCATCATAATTCTGACTTCCACATTCCA
AAAGCCACACTCAAAGATAGCGGCTCCTACTTCTGCAGGGGGCTTGTTGGGAGTAAAAAT
GTGTCTTCAGAGACTGTGAACATCACCATCACTCAAGGTTTGGCAGTGTCAACCATCTCA
TCATTCTCTCCACCTGGGTACCAAGTCTCTTTCTGCTTGGTGATGGTACTCCTTTTTGCA
GTGGACACAGGACTATATTTCTCTGTGAAGACAAACATTTGA
|
| GenBank Gene ID |
X16863 |
| GeneCard ID |
FCGR3B |
| GenAtlas ID |
FCGR3B |
| HGNC ID |
HGNC:3620 |
| HPRD ID |
09951 |
| IUPHAR ID |
Not Available |
| Guide to Pharmacology ID |
Not Available |
| Chromosome Location |
Not Available |
| Locus |
1q23 |
| SNPs |
FCGR3B |
| General References |
- Ravetch JV, Perussia B: Alternative membrane forms of Fc gamma RIII on human natural killer cells and neutrophils. Cell type-specific expression of two genes that differ in single nucleotide substitutions. J Exp Med. 1989 Aug 1;170(2):481-97. Pubmed
- Simmons D, Seed B: The Fc gamma receptor of natural killer cells is a phospholipid-linked membrane protein. Nature. 1988 Jun 9;333(6173):568-70. Pubmed
- Peltz GA, Grundy HO, Lebo RV, Yssel H, Barsh GS, Moore KW: Human Fc gamma RIII: cloning, expression, and identification of the chromosomal locus of two Fc receptors for IgG. Proc Natl Acad Sci U S A. 1989 Feb;86(3):1013-7. Pubmed
- Scallon BJ, Scigliano E, Freedman VH, Miedel MC, Pan YC, Unkeless JC, Kochan JP: A human immunoglobulin G receptor exists in both polypeptide-anchored and phosphatidylinositol-glycan-anchored forms. Proc Natl Acad Sci U S A. 1989 Jul;86(13):5079-83. Pubmed
- Gessner JE, Grussenmeyer T, Kolanus W, Schmidt RE: The human low affinity immunoglobulin G Fc receptor III-A and III-B genes. Molecular characterization of the promoter regions. J Biol Chem. 1995 Jan 20;270(3):1350-61. Pubmed
- Sondermann P, Huber R, Oosthuizen V, Jacob U: The 3.2-A crystal structure of the human IgG1 Fc fragment-Fc gammaRIII complex. Nature. 2000 Jul 20;406(6793):267-73. Pubmed
- Zhang Y, Boesen CC, Radaev S, Brooks AG, Fridman WH, Sautes-Fridman C, Sun PD: Crystal structure of the extracellular domain of a human Fc gamma RIII. Immunity. 2000 Sep;13(3):387-95. Pubmed
- Bux J, Stein EL, Bierling P, Fromont P, Clay M, Stroncek D, Santoso S: Characterization of a new alloantigen (SH) on the human neutrophil Fc gamma receptor IIIb. Blood. 1997 Feb 1;89(3):1027-34. Pubmed
|
| Drugs |
| # |
DrugBank ID |
Drug Name |
Drug Type |
Drug Groups |
| 1 |
DB00054 |
Abciximab |
biotech |
approved |
| 2 |
DB00051 |
Adalimumab |
biotech |
approved |
| 3 |
DB00092 |
Alefacept |
biotech |
approved, investigational |
| 4 |
DB00087 |
Alemtuzumab |
biotech |
approved, investigational |
| 5 |
DB00074 |
Basiliximab |
biotech |
approved, investigational |
| 6 |
DB00112 |
Bevacizumab |
biotech |
approved, investigational |
| 7 |
DB00002 |
Cetuximab |
biotech |
approved |
| 8 |
DB00111 |
Daclizumab |
biotech |
approved, investigational |
| 9 |
DB00095 |
Efalizumab |
biotech |
approved, investigational |
| 10 |
DB00005 |
Etanercept |
biotech |
approved, investigational |
| 11 |
DB00056 |
Gemtuzumab ozogamicin |
biotech |
approved, investigational |
| 12 |
DB00078 |
Ibritumomab |
biotech |
approved |
| 13 |
DB00028 |
Intravenous Immunoglobulin |
biotech |
approved, investigational |
| 14 |
DB00075 |
Muromonab |
biotech |
approved |
| 15 |
DB00108 |
Natalizumab |
biotech |
approved, investigational |
| 16 |
DB00110 |
Palivizumab |
biotech |
approved, investigational |
| 17 |
DB00073 |
Rituximab |
biotech |
approved |
| 18 |
DB00081 |
Tositumomab |
biotech |
approved |
| 19 |
DB00072 |
Trastuzumab |
biotech |
approved, investigational |
|
