Banner

Adenine phosphoribosyltransferase

ID 128
Name Adenine phosphoribosyltransferase
Synonyms
  • EC 2.4.2.7
  • APRT
Gene Name APRT
Protein Sequence
>Adenine phosphoribosyltransferase
ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYI
AGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQ
RVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
Number of Residues 179
Molecular Weight 19477
Theoretical pI 5.82
GO Classification
Function
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
transferase activity, transferring pentosyl groups
adenine phosphoribosyltransferase activity
Process
nucleobase metabolism
purine base metabolism
purine base salvage
physiological process
adenine salvage
metabolism
cellular metabolism
nucleobase, nucleoside, nucleotide and nucleic acid metabolism
nucleoside metabolism
General Function Nucleotide transport and metabolism
Specific Function Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis
Pathways Not Available
Reactions
  • AMP + diphosphate = adenine + 5-phospho-alpha-D-ribose 1-diphosphate
Pfam Domain Function
Signals None
Transmembrane Regions None
Essentiality Non-Essential
GenBank Protein ID 28819 Link_out
UniProtKB ID P07741 Link_out
UniProtKB Entry Name APT_HUMAN Link_out
PDB ID 1ORE Link_out
PDB File show
3D Structure View 3D Structure
Cellular Location Cytoplasm
Gene Sequence
>543 bp
ATGGCCGACTCCGAGCTGCAGCTGGTTGAGCAGCGGATCCGCAGCTTCCCCGACTTCCCC
ACCCCAGGCGTGGTATTCAGGGACATCTCGCCCGTCCTGAAGGACCCCGCCTCCTTCCGC
GCCGCCATCGGCCTCCTGGCGCGACACCTGAAGGCGACCCACGGGGGCCGCATCGACTAC
ATCGCAGGCCTAGACTCCCGAGGCTTCCTCTTTGGCCCCTCCCTGGCCCAGGAGCTTGGA
CTGGGCTGCGTGCTCATCCGAAAGCGGGGGAAGCTGCCAGGCCCCACTCTGTGGGCCTCC
TATTCCCTGGAGTACGGGAAGGCTGAGCTGGAGATTCAGAAAGACGCCCTGGAGCCAGGA
CAGAGGGTGGTCGTCGTGGATGATCTGCTGGCCACTGGTGGAACCATGAACGCTGCCTGT
GAGCTGCTGGGCCGCCTGCAGGCTGAGGTCCTGGAGTGCGTGAGCCTGGTGGAGCTGACC
TCGCTTAAGGGCAGGGAGAAGCTGGCACCTGTACCCTTCTTCTCTCTCCTGCAGTATGAG
TGA
GenBank Gene ID Y00486 Link_out
GeneCard ID APRT Link_out
GenAtlas ID APRT Link_out
HGNC ID HGNC:626 Link_out
HPRD ID 00029
IUPHAR ID Not Available
Guide to Pharmacology ID Not Available
Chromosome Location Not Available
Locus 16q24
SNPs APRT Link_out
General References
  1. Wilson JM, O’Toole TE, Argos P, Shewach DS, Daddona PE, Kelley WN: Human adenine phosphoribosyltransferase. Complete amino acid sequence of the erythrocyte enzyme. J Biol Chem. 1986 Oct 15;261(29):13677-83. Pubmed
  2. Hidaka Y, Tarle SA, O’Toole TE, Kelley WN, Palella TD: Nucleotide sequence of the human APRT gene. Nucleic Acids Res. 1987 Nov 11;15(21):9086. Pubmed
  3. Broderick TP, Schaff DA, Bertino AM, Dush MK, Tischfield JA, Stambrook PJ: Comparative anatomy of the human APRT gene and enzyme: nucleotide sequence divergence and conservation of a nonrandom CpG dinucleotide arrangement. Proc Natl Acad Sci U S A. 1987 May;84(10):3349-53. Pubmed
  4. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. Pubmed
  5. Chen J, Sahota A, Laxdal T, Scrine M, Bowman S, Cui C, Stambrook PJ, Tischfield JA: Identification of a single missense mutation in the adenine phosphoribosyltransferase (APRT) gene from five Icelandic patients and a British patient. Am J Hum Genet. 1991 Dec;49(6):1306-11. Pubmed
  6. Sahota A, Chen J, Boyadjiev SA, Gault MH, Tischfield JA: Missense mutation in the adenine phosphoribosyltransferase gene causing 2,8-dihydroxyadenine urolithiasis. Hum Mol Genet. 1994 May;3(5):817-8. Pubmed
  7. Hidaka Y, Palella TD, O’Toole TE, Tarle SA, Kelley WN: Human adenine phosphoribosyltransferase. Identification of allelic mutations at the nucleotide level as a cause of complete deficiency of the enzyme. J Clin Invest. 1987 Nov;80(5):1409-15. Pubmed
  8. Hidaka Y, Tarle SA, Fujimori S, Kamatani N, Kelley WN, Palella TD: Human adenine phosphoribosyltransferase deficiency. Demonstration of a single mutant allele common to the Japanese. J Clin Invest. 1988 Mar;81(3):945-50. Pubmed
  9. Kamatani N, Hakoda M, Otsuka S, Yoshikawa H, Kashiwazaki S: Only three mutations account for almost all defective alleles causing adenine phosphoribosyltransferase deficiency in Japanese patients. J Clin Invest. 1992 Jul;90(1):130-5. Pubmed
  10. Deng L, Yang M, Frund S, Wessel T, De Abreu RA, Tischfield JA, Sahota A: 2,8-Dihydroxyadenine urolithiasis in a patient with considerable residual adenine phosphoribosyltransferase activity in cell extracts but with mutations in both copies of APRT. Mol Genet Metab. 2001 Mar;72(3):260-4. Pubmed
Drugs
# DrugBank ID Drug Name Drug Type Drug Groups
1 DB03506 9-Deazaadenine small molecule experimental
2 DB00173 Adenine small molecule approved, nutraceutical
3 DB00131 Adenosine monophosphate small molecule approved, nutraceutical
4 DB01632 Alpha-Phosphoribosylpyrophosphoric Acid small molecule experimental
5 DB04272 Citric Acid small molecule experimental