Banner

Sodium/potassium-transporting ATPase gamma chain

ID 253
Name Sodium/potassium-transporting ATPase gamma chain
Synonyms
  • Sodium pump gamma chain
  • Na(+)/K(+) ATPase subunit gamma
  • FXYD domain-containing ion transport regulator 2
Gene Name FXYD2
Protein Sequence 
>Sodium/potassium-transporting ATPase gamma chain
MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQ
INEDEP
Number of Residues 66
Molecular Weight 7283
Theoretical pI 8.47
GO Classification
Component
membrane
cell
Function
transporter activity
ion transporter activity
ion channel activity
Process
ion transport
physiological process
cellular physiological process
transport
General Function Involved in ion channel activity
Specific Function May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase
Pathways
Name SMPDB Link KEGG Link
Chlorothiazide Pathway SMP00078
Polythiazide Pathway SMP00080
Methyclothiazide Pathway SMP00081
Bumetanide Pathway SMP00088
Bendroflumethiazide Pathway SMP00090
Quinethazone Pathway SMP00091
Ethacrynic Acid pathway SMP00097
Hydrochlorothiazide Pathway SMP00100
Cyclothiazide Pathway SMP00103
Metolazone Pathway SMP00105
Hydroflumethiazide Pathway SMP00108
Indapamide Pathway SMP00110
Furosemide Pathway SMP00115
Torsemide Pathway SMP00118
Trichlormethiazide Pathway SMP00121
Chlorthalidone Pathway SMP00122
Triamterene Pathway SMP00132
Amiloride Pathway SMP00133
Spironolactone Pathway SMP00134
Eplerenone Pathway SMP00135
Benazepril Pathway SMP00145
Captopril Pathway SMP00146
Cilazapril Pathway SMP00147
Enalapril Pathway SMP00148
Fosinopril Pathway SMP00149
Lisinopril Pathway SMP00150
Moexipril Pathway SMP00151
Perindopril Pathway SMP00152
Quinapril Pathway SMP00153
Ramipril Pathway SMP00154
Rescinnamine Pathway SMP00155
Spirapril Pathway SMP00156
Trandolapril Pathway SMP00157
Quinidine Pathway SMP00323
Procainamide (Antiarrhythmic) Pathway SMP00324
Disopyramide Pathway SMP00325
Fosphenytoin (Antiarrhythmic) Pathway SMP00326
Phenytoin (Antiarrhythmic) Pathway SMP00327
Lidocaine (Antiarrhythmic) Pathway SMP00328
Mexiletine Pathway SMP00329
Tocainide Pathway SMP00330
Flecainide Pathway SMP00331
Ibutilide Pathway SMP00332
Diltiazem Pathway SMP00359
Verapamil Pathway SMP00375
Benzocaine Pathway SMP00392
Bupivacaine Pathway SMP00393
Chloroprocaine Pathway SMP00394
Cocaine Pathway SMP00395
Dibucaine Pathway SMP00396
Levobupivacaine Pathway SMP00397
Lidocaine (Local Anaesthetic) Pathway SMP00398
Mepivacaine Pathway SMP00399
Oxybuprocaine Pathway SMP00400
Prilocaine Pathway SMP00401
Procaine Pathway SMP00402
Proparacaine Pathway SMP00403
Ropivacaine Pathway SMP00404
Reactions Not Available
Pfam Domain Function
Signals None
Transmembrane Regions 29-46
Essentiality Non-Essential
GenBank Protein ID 1575004 Link_out
UniProtKB ID P54710 Link_out
UniProtKB Entry Name ATNG_HUMAN Link_out
PDB ID Not Available
Cellular Location Membrane; single-pass type III membrane protein (Potential)
Gene Sequence 
>177 bp
GTGGCGGCAGCCAAGGGGGACGTGGACCCGTTCTACTATGACTATGAGACCGTTCGCAAT
GGGGGCCTGATCTTCGCTGGACTGGCCTTCATCGTGGGGCTCCTCATCCTCCTCAGCAGA
AGATTCCGCTGTGGGGGCAATAAGAAGCGCAGGCAAATCAATGAAGATGAGCCGTAA
GenBank Gene ID U50743 Link_out
GeneCard ID FXYD2 Link_out
GenAtlas ID FXYD2 Link_out
HGNC ID HGNC:4026 Link_out
HPRD ID 03487
IUPHAR ID Not Available
Guide to Pharmacology ID Not Available
Chromosome Location Not Available
Locus 11q23
SNPs FXYD2 Link_out
General References
  1. Kim JW, Lee Y, Lee IA, Kang HB, Choe YK, Choe IS: Cloning and expression of human cDNA encoding Na+, K(+)-ATPase gamma-subunit. Biochim Biophys Acta. 1997 Feb 7;1350(2):133-5. Pubmed
  2. Sweadner KJ, Wetzel RK, Arystarkhova E: Genomic organization of the human FXYD2 gene encoding the gamma subunit of the Na,K-ATPase. Biochem Biophys Res Commun. 2000 Dec 9;279(1):196-201. Pubmed
  3. Meij IC, Koenderink JB, van Bokhoven H, Assink KF, Groenestege WT, de Pont JJ, Bindels RJ, Monnens LA, van den Heuvel LP, Knoers NV: Dominant isolated renal magnesium loss is caused by misrouting of the Na(),K()-ATPase gamma-subunit. Nat Genet. 2000 Nov;26(3):265-6. Pubmed
Drugs
# DrugBank ID Drug Name Drug Type Drug Groups
1 DB00606 Cyclothiazide small molecule approved