| ID |
3816 |
| Name |
Complement C1q subcomponent subunit B |
| Synonyms |
- Complement C1q subcomponent subunit B precursor
|
| Gene Name |
C1QB |
| Protein Sequence |
>Complement C1q subcomponent subunit B
MKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEK
GLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKI
AFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCV
NLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIF
SGFLLFPDMEA
|
| Number of Residues |
251 |
| Molecular Weight |
26460 |
| Theoretical pI |
8.87 |
| GO Classification |
| Component |
| cell |
| intracellular |
| cytoplasm |
| Process |
| physiological process |
| cellular physiological process |
| transport |
| ion transport |
| anion transport |
| inorganic anion transport |
| phosphate transport |
|
| General Function |
Not Available |
| Specific Function |
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes |
| Pathways |
Not Available |
| Reactions |
Not Available |
| Pfam Domain Function |
|
| Signals |
1-25 |
| Transmembrane Regions |
None |
| Essentiality |
Non-Essential |
| GenBank Protein ID |
573114  |
| UniProtKB ID |
P02746 |
| UniProtKB Entry Name |
C1QB_HUMAN |
| PDB ID |
1PK6 |
| PDB File |
show |
| 3D Structure |
View 3D Structure |
| Cellular Location |
Secreted protein |
| Gene Sequence |
>688 bp
CCAGGCCCAGCTCAGCTGCACCGGGCCCCCAGCCATCCCTGGCATCCCGGGTATCCCTGG
GACACCTGGCCCCGATGGCCAACCTGGGACCCCAGGGATAAAAGGAGAGAAAGGGCTTCC
AGGGCTGGCTGGAGACCATGGTGAGTTCGGAGAGAAGGGAGACCCAGGGATTCCTGGGAA
TCCAGGAAAAGTCGGCCCCAAGGGCCCCATGGGCCCTAAAGGTGGCCCAGGGGCCCCTGG
AGCCCCAGGCCCCAAAGGTGAATCGGGAGACTACAAGGCCACCCAGAAAATCGCCTTCTC
TGCCACAAGAACCATCAACGTCCCCCTGCGCCGGGACCAGACCATCCGCTTCGACCACGT
GATCACCAACATGAACAACAATTATGAGCCCCGCAGTGGCAAGTTCACCTGCAAGGTGCC
CGGTCTCTACTACTTCACCTACCACGCCAGCTCTCGAGGGAACCTGTGCGTGAACCTCAT
GCGTGGCCGGGAGCGTGCACAGAAGGTGGTCACCTTCTGTGACTATGCCTACAACACCTT
CCAGGTCACCACCGGTGGCATGGTCCTCAAGCTGGAGCAGGGGGAGAACGTCTTCCTGCA
GGCCACCGACAAGAACTCACTACTGGGCATGGAGGGTGCCAACAGCATCTTTTCCGGGTT
CCTGCTCTTTCCAGATATGGAGGCCTGA
|
| GenBank Gene ID |
X03084 |
| GeneCard ID |
C1QB |
| GenAtlas ID |
C1QB |
| HGNC ID |
HGNC:1242 |
| HPRD ID |
Not Available |
| IUPHAR ID |
Not Available |
| Guide to Pharmacology ID |
Not Available |
| Chromosome Location |
Not Available |
| Locus |
1p36.12 |
| SNPs |
C1QB |
| General References |
- Reid KB: Molecular cloning and characterization of the complementary DNA and gene coding for the B-chain of subcomponent C1q of the human complement system. Biochem J. 1985 Nov 1;231(3):729-35. Pubmed
- Reid KB: Complete amino acid sequences of the three collagen-like regions present in subcomponent C1q of the first component of human complement. Biochem J. 1979 May 1;179(2):367-71. Pubmed
- Reid KB, Thompson EO: Amino acid sequence of the N-terminal 108 amino acid residues of the B chain of subcomponent C1q of the first component of human complement. Biochem J. 1978 Sep 1;173(3):863-8. Pubmed
- Reid KB, Gagnon J, Frampton J: Completion of the amino acid sequences of the A and B chains of subcomponent C1q of the first component of human complement. Biochem J. 1982 Jun 1;203(3):559-69. Pubmed
- Reid KB, Bentley DR, Wood KJ: Cloning and characterization of the complementary DNA for the B chain of normal human serum C1q. Philos Trans R Soc Lond B Biol Sci. 1984 Sep 6;306(1129):345-54. Pubmed
- Gaboriaud C, Juanhuix J, Gruez A, Lacroix M, Darnault C, Pignol D, Verger D, Fontecilla-Camps JC, Arlaud GJ: The crystal structure of the globular head of complement protein C1q provides a basis for its versatile recognition properties. J Biol Chem. 2003 Nov 21;278(47):46974-82. Epub 2003 Sep 5. Pubmed
- Petry F: Molecular basis of hereditary C1q deficiency. Immunobiology. 1998 Aug;199(2):286-94. Pubmed
|
| Drugs |
| # |
DrugBank ID |
Drug Name |
Drug Type |
Drug Groups |
| 1 |
DB00054 |
Abciximab |
biotech |
approved |
| 2 |
DB00051 |
Adalimumab |
biotech |
approved |
| 3 |
DB00092 |
Alefacept |
biotech |
approved, investigational |
| 4 |
DB00087 |
Alemtuzumab |
biotech |
approved, investigational |
| 5 |
DB00074 |
Basiliximab |
biotech |
approved, investigational |
| 6 |
DB00112 |
Bevacizumab |
biotech |
approved, investigational |
| 7 |
DB00002 |
Cetuximab |
biotech |
approved |
| 8 |
DB00111 |
Daclizumab |
biotech |
approved, investigational |
| 9 |
DB00095 |
Efalizumab |
biotech |
approved, investigational |
| 10 |
DB00005 |
Etanercept |
biotech |
approved, investigational |
| 11 |
DB00056 |
Gemtuzumab ozogamicin |
biotech |
approved, investigational |
| 12 |
DB00078 |
Ibritumomab |
biotech |
approved |
| 13 |
DB00075 |
Muromonab |
biotech |
approved |
| 14 |
DB00108 |
Natalizumab |
biotech |
approved, investigational |
| 15 |
DB00110 |
Palivizumab |
biotech |
approved, investigational |
| 16 |
DB00073 |
Rituximab |
biotech |
approved |
| 17 |
DB00081 |
Tositumomab |
biotech |
approved |
| 18 |
DB00072 |
Trastuzumab |
biotech |
approved, investigational |
|
