| ID |
4945 |
| Name |
Cytochrome c3 |
| Synonyms |
Not Available |
| Gene Name |
Not Available |
| Protein Sequence |
>Cytochrome c3
VDVPADGAKIDFIAGGEKNLTVVFNHSTHKDVKCDDCHHDPGDKQYAGCTTDGCHNILDK
ADKSVNSWYKVVHDAKGGAKPTCISCHKDKAGDDKELKKKLTGCKGSACHPS
|
| Number of Residues |
112 |
| Molecular Weight |
11978 |
| Theoretical pI |
7.47 |
| GO Classification |
| Function |
| tetrapyrrole binding |
| binding |
| heme binding |
| ion binding |
| cation binding |
| transition metal ion binding |
| iron ion binding |
| transporter activity |
| electron transporter activity |
| Process |
| generation of precursor metabolites and energy |
| electron transport |
| physiological process |
| energy derivation by oxidation of organic compounds |
| cellular respiration |
| aerobic respiration |
| aerobic respiration, using sulfur or sulfate as electron donor |
| metabolism |
| cellular metabolism |
|
| General Function |
Involved in iron ion binding |
| Specific Function |
Participates in sulfate respiration coupled with phosphorylation by transferring electrons from the enzyme dehydrogenase to ferredoxin |
| Pathways |
Not Available |
| Reactions |
Not Available |
| Pfam Domain Function |
|
| Signals |
None |
| Transmembrane Regions |
None |
| Essentiality |
Non-Essential |
| GenBank Protein ID |
Not Available |
| UniProtKB ID |
P00133  |
| UniProtKB Entry Name |
CYC3_DESGI |
| PDB ID |
1WAD |
| PDB File |
show |
| 3D Structure |
View 3D Structure |
| Cellular Location |
Not Available |
| Gene Sequence |
Not Available
|
| GenBank Gene ID |
Not Available |
| GeneCard ID |
Not Available |
| GenAtlas ID |
Not Available |
| HGNC ID |
Not Available |
| HPRD ID |
Not Available |
| IUPHAR ID |
Not Available |
| Guide to Pharmacology ID |
Not Available |
| Chromosome Location |
Not Available |
| Locus |
Not Available |
| SNPs |
Not Available |
| General References |
- Matias PM, Morais J, Coelho R, Carrondo MA, Wilson K, Dauter Z, Sieker L: Cytochrome c3 from Desulfovibrio gigas: crystal structure at 1.8 A resolution and evidence for a specific calcium-binding site. Protein Sci. 1996 Jul;5(7):1342-54. Pubmed
|
| Drugs |
| # |
DrugBank ID |
Drug Name |
Drug Type |
Drug Groups |
| 1 |
DB03014 |
Heme |
small molecule |
experimental |
|
