Banner

Solute carrier family 22 member 8

ID 6142
Name Solute carrier family 22 member 8
Synonyms
  • Organic anion transporter 3
  • hOAT3
Gene Name SLC22A8
Protein Sequence
>Solute carrier family 22 member 8
MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPW
VLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNK
LKEMAQSIFMAGILIGGLVLGDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFPIYMVFR
FLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAYAIPQWRWLQL
TVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLN
LQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEEFGVNLYILQI
IFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKG
CLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGI
TALLGGSAALFLPETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLG
SS
Number of Residues 542
Molecular Weight 59855.6
Theoretical pI 9.05
GO Classification
Component
integral to membrane
membrane
cell
intrinsic to membrane
Function
transporter activity
ion transporter activity
Process
physiological process
cellular physiological process
transport
ion transport
General Function Carbohydrate transport and metabolism
Specific Function Plays an important role in the excretion/detoxification of endogenous and exogenous organic anions, especially from the brain and kidney. Involved in the transport basolateral of steviol, fexofenadine. Transports benzylpenicillin (PCG), estrone- 3-sulfate (E1S), cimetidine (CMD), 2,4-dichloro-phenoxyacetate (2,4-D), p-amino-hippurate (PAH), acyclovir (ACV) and ochratoxin (OTA)
Pathways Not Available
Reactions Not Available
Pfam Domain Function
Signals None
Transmembrane Regions 10-30 124-144 155-175 177-197 213-233 237-257 328-348 355-375 387-407 412-432 472-492
Essentiality Non-Essential
GenBank Protein ID 4378059 Link_out
UniProtKB ID Q8TCC7 Link_out
UniProtKB Entry Name S22A8_HUMAN Link_out
PDB ID Not Available
Cellular Location Basolateral cell membrane
Gene Sequence Not Available
GenBank Gene ID AF097491 Link_out
GeneCard ID SLC22A8 Link_out
GenAtlas ID Not Available
HGNC ID GNC:10972 Link_out
HPRD ID Not Available
IUPHAR ID Not Available
Guide to Pharmacology ID Not Available
Chromosome Location 1
Locus 11q11
SNPs SLC22A8 Link_out
General References
  1. Race JE, Grassl SM, Williams WJ, Holtzman EJ: Molecular cloning and characterization of two novel human renal organic anion transporters (hOAT1 and hOAT3). Biochem Biophys Res Commun. 1999 Feb 16;255(2):508-14. Pubmed
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. Pubmed
  3. Motohashi H, Sakurai Y, Saito H, Masuda S, Urakami Y, Goto M, Fukatsu A, Ogawa O, Inui K: Gene expression levels and immunolocalization of organic ion transporters in the human kidney. J Am Soc Nephrol. 2002 Apr;13(4):866-74. Pubmed
  4. Bakhiya A, Bahn A, Burckhardt G, Wolff N: Human organic anion transporter 3 (hOAT3) can operate as an exchanger and mediate secretory urate flux. Cell Physiol Biochem. 2003;13(5):249-56. Pubmed
  5. Srimaroeng C, Chatsudthipong V, Aslamkhan AG, Pritchard JB: Transport of the natural sweetener stevioside and its aglycone steviol by human organic anion transporter (hOAT1; SLC22A6) and hOAT3 (SLC22A8). J Pharmacol Exp Ther. 2005 May;313(2):621-8. Epub 2005 Jan 11. Pubmed
  6. Tahara H, Shono M, Kusuhara H, Kinoshita H, Fuse E, Takadate A, Otagiri M, Sugiyama Y: Molecular cloning and functional analyses of OAT1 and OAT3 from cynomolgus monkey kidney. Pharm Res. 2005 Apr;22(4):647-60. Epub 2005 Apr 7. Pubmed
  7. Tahara H, Kusuhara H, Maeda K, Koepsell H, Fuse E, Sugiyama Y: Inhibition of oat3-mediated renal uptake as a mechanism for drug-drug interaction between fexofenadine and probenecid. Drug Metab Dispos. 2006 May;34(5):743-7. Epub 2006 Feb 2. Pubmed
  8. Nishizato Y, Ieiri I, Suzuki H, Kimura M, Kawabata K, Hirota T, Takane H, Irie S, Kusuhara H, Urasaki Y, Urae A, Higuchi S, Otsubo K, Sugiyama Y: Polymorphisms of OATP-C (SLC21A6) and OAT3 (SLC22A8) genes: consequences for pravastatin pharmacokinetics. Clin Pharmacol Ther. 2003 Jun;73(6):554-65. Pubmed
Drugs
# DrugBank ID Drug Name Drug Type Drug Groups
1 DB00787 Acyclovir small molecule approved
2 DB00437 Allopurinol small molecule approved
3 DB00345 Aminohippurate small molecule approved
4 DB00168 Aspartame small molecule approved, nutraceutical
5 DB00181 Baclofen small molecule approved
6 DB03793 Benzoic Acid small molecule experimental
7 DB00887 Bumetanide small molecule approved
8 DB04519 Caprylic acid small molecule experimental
9 DB01414 Cefacetrile small molecule approved
10 DB01140 Cefadroxil small molecule approved
11 DB00456 Cefalotin small molecule approved
12 DB01326 Cefamandole small molecule approved
13 DB01327 Cefazolin small molecule approved
14 DB01329 Cefoperazone small molecule approved
15 DB00493 Cefotaxime small molecule approved
16 DB01212 Ceftriaxone small molecule approved
17 DB00567 Cephalexin small molecule approved
18 DB02659 Cholic Acid small molecule experimental
19 DB01597 Cilastatin small molecule approved
20 DB00501 Cimetidine small molecule approved
21 DB00286 Conjugated Estrogens small molecule approved
22 DB02527 Cyclic Adenosine Monophosphate small molecule experimental
23 DB04133 Degraded Cephaloridine small molecule experimental
24 DB00586 Diclofenac small molecule approved
25 DB00390 Digoxin small molecule approved
26 DB01160 Dinoprost Tromethamine small molecule approved
27 DB00917 Dinoprostone small molecule approved
28 DB00254 Doxycycline small molecule approved, investigational
29 DB00584 Enalapril small molecule approved
30 DB00783 Estradiol small molecule approved, investigational
31 DB00927 Famotidine small molecule approved
32 DB00695 Furosemide small molecule approved
33 DB01004 Ganciclovir small molecule approved, investigational
34 DB03553 Glutaric Acid small molecule experimental
35 DB00536 Guanidine small molecule approved
36 DB01050 Ibuprofen small molecule approved
37 DB00328 Indomethacin small molecule approved, investigational
38 DB01009 Ketoprofen small molecule approved
39 DB00583 L-Carnitine small molecule approved
40 DB00279 Liothyronine small molecule approved
41 DB01583 Liotrix small molecule approved
42 DB01065 Melatonin small molecule approved, nutraceutical
43 DB01033 Mercaptopurine small molecule approved
44 DB00563 Methotrexate small molecule approved
45 DB06710 Methyltestosterone small molecule approved
46 DB01017 Minocycline small molecule approved, investigational
47 DB01051 Novobiocin small molecule approved
48 DB00198 Oseltamivir small molecule approved
49 DB01092 Ouabain small molecule approved
50 DB03902 Oxalic Acid small molecule experimental
51 DB00595 Oxytetracycline small molecule approved
52 DB01053 Penicillin G small molecule approved
53 DB00812 Phenylbutazone small molecule approved
54 DB00554 Piroxicam small molecule approved, investigational
55 DB00175 Pravastatin small molecule approved
56 DB01032 Probenecid small molecule approved
57 DB00908 Quinidine small molecule approved
58 DB00863 Ranitidine small molecule approved
59 DB00936 Salicyclic acid small molecule approved
60 DB06335 Saxagliptin small molecule approved
61 DB00139 Succinic acid small molecule approved, nutraceutical
62 DB04348 Taurocholic Acid small molecule experimental
63 DB00469 Tenoxicam small molecule approved
64 DB00624 Testosterone small molecule approved, investigational
65 DB00759 Tetracycline small molecule approved
66 DB01650 trans-2-hydroxycinnamic acid small molecule experimental
67 DB00577 Valaciclovir small molecule approved, investigational
68 DB00313 Valproic Acid small molecule approved, investigational
69 DB00495 Zidovudine small molecule approved