Banner

Translocator protein

ID 811
Name Translocator protein
Synonyms
  • Peripheral-type benzodiazepine receptor
  • PBR
  • PKBS
  • Mitochondrial benzodiazepine receptor
Gene Name TSPO
Protein Sequence 
>Peripheral-type benzodiazepine receptor
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE
Number of Residues 169
Molecular Weight 18779
Theoretical pI 9.33
GO Classification
Component
cell
intrinsic to membrane
integral to membrane
membrane
General Function Signal transduction mechanisms
Specific Function Responsible for the manifestation of peripheral-type benzodiazepine recognition sites and is most likely to comprise binding domains for benzodiazepines and isoquinoline carboxamides. May play a role in the transport of porphyrins and heme
Pathways Not Available
Reactions Not Available
Pfam Domain Function
Signals None
Transmembrane Regions 6-26 47-67 80-100 106-126 135-155
Essentiality Non-Essential
GenBank Protein ID 306883 Link_out
UniProtKB ID P30536 Link_out
UniProtKB Entry Name TSPOA_HUMAN Link_out
PDB ID Not Available
Cellular Location Mitochondrion; mitochondrial membrane; multi-pass membrane protein
Gene Sequence 
>510 bp
ATGGCCCCGCCCTGGGTGCCCGCCATGGGCTTCACGCTGGCGCCCAGCCTGGGGTGCTTC
GTGGGCTCCCGCTTTGTCCACGGCGAGGGTCTCCGCTGGTACGCCGGCCTGCAGAAGCCC
TCGTGGCACCCGCCCCACTGGGTGCTGGGCCCTGTCTGGGGCACGCTCTACTCAGCCATG
GGGTACGGCTCCTACCTGGTCTGGAAAGAGCTGGGAGGCTTCACAGAGAAGGCTGTGGTT
CCCCTGGGCCTCTACACTGGGCAGCTGGCCCTGAACTGGGCATGGCCCCCCATCTTCTTT
GGTGCCCGACAAATGGGCTGGGCCTTGGTGGATCTCCTGCTGGTCAGTGGGGCGGCGGCN
GCCACTACCGTGGCCTGGTACCAGGTGAGCCCGCTGGCCGCCCGCCTGCTCTACCCCTAC
CTGGCCTGGCTGGCCTTCGCGACCACACTCAACTACTGCGTATGGCGGGACAACCATGGC
TGGCATGGGGGACGGCGGCTGCCAGAGTGA
GenBank Gene ID M36035 Link_out
GeneCard ID TSPO Link_out
GenAtlas ID TSPO Link_out
HGNC ID HGNC:1158 Link_out
HPRD ID 15913
IUPHAR ID Not Available
Guide to Pharmacology ID Not Available
Chromosome Location Not Available
Locus 22q13.31
SNPs TSPO Link_out
General References
  1. Riond J, Mattei MG, Kaghad M, Dumont X, Guillemot JC, Le Fur G, Caput D, Ferrara P: Molecular cloning and chromosomal localization of a human peripheral-type benzodiazepine receptor. Eur J Biochem. 1991 Jan 30;195(2):305-11. Pubmed
  2. Yakovlev AG, Ruffo M, Jurka J, Krueger KE: Comparison of repetitive elements in the third intron of human and rodent mitochondrial benzodiazepine receptor-encoding genes. Gene. 1995 Apr 3;155(2):201-5. Pubmed
  3. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O’Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. Pubmed
  4. Galiegue S, Jbilo O, Combes T, Bribes E, Carayon P, Le Fur G, Casellas P: Cloning and characterization of PRAX-1. A new protein that specifically interacts with the peripheral benzodiazepine receptor. J Biol Chem. 1999 Jan 29;274(5):2938-52. Pubmed
  5. Kurumaji A, Nomoto H, Yoshikawa T, Okubo Y, Toru M: An association study between two missense variations of the benzodiazepine receptor (peripheral) gene and schizophrenia in a Japanese sample. J Neural Transm. 2000;107(4):491-500. Pubmed
  6. Kurumaji A, Nomoto H, Yamada K, Yoshikawa T, Toru M: No association of two missense variations of the benzodiazepine receptor (peripheral) gene and mood disorders in a Japanese sample. Am J Med Genet. 2001 Mar 8;105(2):172-5. Pubmed
Drugs
# DrugBank ID Drug Name Drug Type Drug Groups
1 DB00404 Alprazolam small molecule illicit, approved, investigational
2 DB01178 Chlormezanone small molecule approved, withdrawn
3 DB01068 Clonazepam small molecule illicit, approved
4 DB00628 Clorazepate small molecule illicit, approved
5 DB00829 Diazepam small molecule illicit, approved
6 DB00402 Eszopiclone small molecule approved
7 DB01544 Flunitrazepam small molecule illicit, approved
8 DB01587 Ketazolam small molecule approved
9 DB00186 Lorazepam small molecule approved
10 DB00231 Temazepam small molecule approved
11 DB00897 Triazolam small molecule illicit, approved, withdrawn
12 DB00962 Zaleplon small molecule illicit, approved, investigational
13 DB01198 Zopiclone small molecule approved