Dihydrofolate reductase
Details
- Name
- Dihydrofolate reductase
- Synonyms
- 1.5.1.3
- Gene Name
- dfrB
- Organism
- Staphylococcus aureus (strain bovine RF122 / ET3-1)
- Amino acid sequence
>lcl|BSEQ0051086|Dihydrofolate reductase TLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNV VLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGD TFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK
- Number of residues
- 157
- Molecular Weight
- 17991.48
- Theoretical pI
- Not Available
- GO Classification
- Functionsdihydrofolate reductase activity / NADP bindingProcessesglycine biosynthetic process / nucleotide biosynthetic process / one-carbon metabolic process / tetrahydrofolate biosynthetic process
- General Function
- Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis.
- Specific Function
- Dihydrofolate reductase activity
- Pfam Domain Function
- DHFR_1 (PF00186)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID A0A0M3KKX1 UniProtKB Entry Name A0A0M3KKX1_STAAB - General References
- Keshipeddy S, Reeve SM, Anderson AC, Wright DL: Nonracemic Antifolates Stereoselectively Recruit Alternate Cofactors and Overcome Resistance in S. aureus. J Am Chem Soc. 2015 Jul 22;137(28):8983-90. doi: 10.1021/jacs.5b01442. Epub 2015 Jul 8. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB06847 5-[(3S)-3-(2-methoxybiphenyl-4-yl)but-1-yn-1-yl]-6-methylpyrimidine-2,4-diamine experimental unknown Details DB07140 5-[(3R)-3-(5-methoxybiphenyl-3-yl)but-1-yn-1-yl]-6-methylpyrimidine-2,4-diamine experimental unknown Details DB07142 5-[(3R)-3-(5-methoxy-3',5'-dimethylbiphenyl-3-yl)but-1-yn-1-yl]-6-methylpyrimidine-2,4-diamine experimental unknown Details DB07153 6-methyl-5-[3-methyl-3-(3,4,5-trimethoxyphenyl)but-1-yn-1-yl]pyrimidine-2,4-diamine experimental unknown Details DB08234 5-[3-(2,5-dimethoxyphenyl)prop-1-yn-1-yl]-6-ethylpyrimidine-2,4-diamine experimental unknown Details