AtpH
Details
- Name
- AtpH
- Synonyms
- Not Available
- Gene Name
- atpH
- Organism
- Arthrospira platensis HN01
- Amino acid sequence
>lcl|BSEQ0022476|AtpH MESNLTTAASVIAAALAVGIGSIGPGLGQGQAAGQAVEGIARQPEAEGKIRGTLLLSLAF MEALTIYGLVVALVLLFANPFV
- Number of residues
- 82
- Molecular Weight
- 8180.505
- Theoretical pI
- 4.33
- GO Classification
- Functionshydrogen ion transmembrane transporter activityProcessesATP hydrolysis coupled proton transport / ATP synthesis coupled proton transportComponentsintegral component of membrane / proton-transporting ATP synthase complex, coupling factor F(o)
- General Function
- Hydrogen ion transmembrane transporter activity
- Specific Function
- Not Available
- Pfam Domain Function
- ATP-synt_C (PF00137)
- Transmembrane Regions
- 54-78
- Cellular Location
- Cytoplasmic
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID A5HEI4 UniProtKB Entry Name A5HEI4_ARTPT GenBank Protein ID 146186464 GenBank Gene ID EF520738 - General References
- Pogoryelov D, Yildiz O, Faraldo-Gomez JD, Meier T: High-resolution structure of the rotor ring of a proton-dependent ATP synthase. Nat Struct Mol Biol. 2009 Oct;16(10):1068-73. doi: 10.1038/nsmb.1678. Epub 2009 Sep 27. [Article]