Penicillin-binding protein 2
Details
- Name
- Penicillin-binding protein 2
- Synonyms
- Not Available
- Gene Name
- mecA
- Organism
- Staphylococcus aureus
- Amino acid sequence
>lcl|BSEQ0022468|Penicillin-binding protein 2 AIHPQTGELLALVSTPSYDVYPFMYGMSNEEYNKLTEDKKEPLLNKFQITTSPGSTQKIL TAMIGLNNKTLDDKTSYKIDGKGWQKDKSWGGYNV
- Number of residues
- 95
- Molecular Weight
- 10694.04
- Theoretical pI
- Not Available
- GO Classification
- Functionspenicillin binding
- General Function
- Penicillin binding
- Specific Function
- Not Available
- Pfam Domain Function
- Transpeptidase (PF00905)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID D6R448 UniProtKB Entry Name D6R448_STAAU - General References
- Rizek CF, Matte MH, Dropa M, Mamizuka EM, de Almeida LM, Lincopan N, Matte GR, Germano PM: Identification of Staphylococcus aureus carrying the mecA gene in ready-to-eat food products sold in Brazil. Foodborne Pathog Dis. 2011 Apr;8(4):561-3. doi: 10.1089/fpd.2010.0706. [Article]